Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YXY1

Protein Details
Accession G2YXY1    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
55-80QITHTHTHPKRSRNPKAQNPSPKFLPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 5, cyto 3, plas 1, extr 1, E.R. 1
Family & Domain DBs
Amino Acid Sequences MILNLFILSIYIFQQALASSSSEAHPQEKNNPRAKPTQQLKPPSPSFHTFPTALQITHTHTHPKRSRNPKAQNPSPKFLPRTNSPSAHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.1
4 0.1
5 0.09
6 0.08
7 0.09
8 0.1
9 0.13
10 0.14
11 0.15
12 0.17
13 0.19
14 0.28
15 0.36
16 0.45
17 0.49
18 0.51
19 0.51
20 0.56
21 0.58
22 0.58
23 0.55
24 0.55
25 0.55
26 0.59
27 0.59
28 0.59
29 0.58
30 0.51
31 0.49
32 0.44
33 0.39
34 0.35
35 0.34
36 0.27
37 0.24
38 0.26
39 0.22
40 0.19
41 0.18
42 0.16
43 0.18
44 0.2
45 0.21
46 0.25
47 0.26
48 0.36
49 0.41
50 0.48
51 0.54
52 0.63
53 0.73
54 0.74
55 0.83
56 0.83
57 0.88
58 0.89
59 0.9
60 0.86
61 0.82
62 0.79
63 0.76
64 0.71
65 0.65
66 0.63
67 0.6
68 0.6
69 0.61