Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YL33

Protein Details
Accession G2YL33    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
119-140ECSRLIKQRTSRHVKQEQEKHDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 9, mito 8, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007252  Nup84/Nup107  
Gene Ontology GO:0031965  C:nuclear membrane  
GO:0031080  C:nuclear pore outer ring  
GO:0017056  F:structural constituent of nuclear pore  
GO:0006406  P:mRNA export from nucleus  
GO:0006606  P:protein import into nucleus  
Pfam View protein in Pfam  
PF04121  Nup84_Nup100  
Amino Acid Sequences MVEQAKSFRELETLALTLDRIESVWGLYYLMQEANDVEEIKNFKRALSQSLPTTKLCADPLLNGWLTTSLQDQPEFAKLRETYLPETILAWIATLQMAGPIFRSIGALLKNGKNARACECSRLIKQRTSRHVKQEQEKHDIEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.14
4 0.12
5 0.11
6 0.09
7 0.06
8 0.06
9 0.06
10 0.06
11 0.08
12 0.07
13 0.08
14 0.08
15 0.08
16 0.09
17 0.09
18 0.09
19 0.08
20 0.08
21 0.09
22 0.09
23 0.1
24 0.09
25 0.11
26 0.14
27 0.15
28 0.21
29 0.19
30 0.18
31 0.23
32 0.24
33 0.28
34 0.3
35 0.33
36 0.32
37 0.37
38 0.39
39 0.34
40 0.34
41 0.28
42 0.25
43 0.22
44 0.18
45 0.14
46 0.12
47 0.14
48 0.14
49 0.14
50 0.12
51 0.11
52 0.1
53 0.1
54 0.09
55 0.09
56 0.08
57 0.09
58 0.09
59 0.09
60 0.1
61 0.15
62 0.16
63 0.14
64 0.18
65 0.17
66 0.19
67 0.22
68 0.23
69 0.21
70 0.21
71 0.22
72 0.17
73 0.17
74 0.15
75 0.13
76 0.1
77 0.08
78 0.06
79 0.06
80 0.05
81 0.05
82 0.04
83 0.05
84 0.05
85 0.05
86 0.06
87 0.06
88 0.06
89 0.06
90 0.07
91 0.06
92 0.09
93 0.1
94 0.12
95 0.17
96 0.19
97 0.25
98 0.26
99 0.3
100 0.31
101 0.32
102 0.35
103 0.38
104 0.38
105 0.37
106 0.41
107 0.44
108 0.47
109 0.54
110 0.53
111 0.54
112 0.61
113 0.65
114 0.71
115 0.74
116 0.74
117 0.75
118 0.79
119 0.8
120 0.82
121 0.82
122 0.79
123 0.78