Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2XQ85

Protein Details
Accession G2XQ85    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
29-48RETRNEKRETRNEKRETRNEBasic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 11.5, cyto 10.5, mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MHVLCGSGGGRWMDGWMGASARWECERERETRNEKRETRNEKRETRNENSEGWGFVYFFVCLFTSFHIDWVISSLATYYYIVTLSAMKSGGLLISAVRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.08
4 0.08
5 0.08
6 0.11
7 0.11
8 0.14
9 0.15
10 0.15
11 0.15
12 0.22
13 0.25
14 0.26
15 0.31
16 0.38
17 0.45
18 0.53
19 0.59
20 0.61
21 0.63
22 0.68
23 0.72
24 0.74
25 0.75
26 0.76
27 0.77
28 0.77
29 0.81
30 0.8
31 0.78
32 0.73
33 0.7
34 0.62
35 0.55
36 0.49
37 0.4
38 0.32
39 0.25
40 0.19
41 0.12
42 0.1
43 0.1
44 0.07
45 0.06
46 0.07
47 0.06
48 0.07
49 0.07
50 0.08
51 0.12
52 0.12
53 0.13
54 0.12
55 0.12
56 0.11
57 0.13
58 0.12
59 0.08
60 0.08
61 0.07
62 0.07
63 0.08
64 0.08
65 0.06
66 0.06
67 0.07
68 0.07
69 0.07
70 0.08
71 0.08
72 0.09
73 0.09
74 0.08
75 0.08
76 0.09
77 0.08
78 0.07
79 0.06