Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2Y2R5

Protein Details
Accession G2Y2R5    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
34-62EKTSKAQRKSTSKIKRNKRGSLVRMKKQRHydrophilic
NLS Segment(s)
PositionSequence
35-62KTSKAQRKSTSKIKRNKRGSLVRMKKQR
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000048  IQ_motif_EF-hand-BS  
Gene Ontology GO:0015629  C:actin cytoskeleton  
GO:0006996  P:organelle organization  
PROSITE View protein in PROSITE  
PS50096  IQ  
Amino Acid Sequences MQIYCLVEFTKNPDRPRGEEEEDARQQQKPGAFEKTSKAQRKSTSKIKRNKRGSLVRMKKQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.48
3 0.54
4 0.54
5 0.48
6 0.48
7 0.48
8 0.48
9 0.47
10 0.45
11 0.41
12 0.34
13 0.29
14 0.27
15 0.26
16 0.2
17 0.21
18 0.23
19 0.22
20 0.23
21 0.26
22 0.32
23 0.38
24 0.44
25 0.45
26 0.46
27 0.53
28 0.6
29 0.64
30 0.67
31 0.69
32 0.7
33 0.76
34 0.81
35 0.83
36 0.84
37 0.86
38 0.85
39 0.85
40 0.85
41 0.87
42 0.86