Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2XW05

Protein Details
Accession G2XW05    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
231-261YCSHCGKKGHLENRCFKKHPKLKGNRGNNKKBasic
NLS Segment(s)
PositionSequence
247-261KKHPKLKGNRGNNKK
Subcellular Location(s) mito 11, cyto 8.5, cyto_nucl 8.5, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF14223  Retrotran_gag_2  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MVSGISFKFDPLRGRSNYIEWINKAKLFLEMNGFMPYIDGTETPPNKALYIDEFGKAISPELAIDYEEKLVEYEINKERAFGAIKSIISYELVERFSDKTTAKSLWDSINSIFGLSSFELMGICLNRLTESNYTSSEGMDEYINSIQSSYSHLKSKYDIPEVFIAWFLFRGLPSSFDGFVSRKYEELAKNEANIDLDKLFSGLISEEARMRSNFESNANKASFKNKNKAPYCSHCGKKGHLENRCFKKHPKLKGNRGNNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.46
3 0.45
4 0.49
5 0.49
6 0.49
7 0.44
8 0.48
9 0.46
10 0.44
11 0.42
12 0.34
13 0.33
14 0.29
15 0.28
16 0.26
17 0.24
18 0.24
19 0.25
20 0.24
21 0.19
22 0.18
23 0.15
24 0.1
25 0.09
26 0.08
27 0.1
28 0.18
29 0.2
30 0.22
31 0.25
32 0.25
33 0.24
34 0.24
35 0.23
36 0.18
37 0.22
38 0.22
39 0.19
40 0.18
41 0.18
42 0.19
43 0.17
44 0.14
45 0.09
46 0.07
47 0.07
48 0.08
49 0.09
50 0.08
51 0.09
52 0.09
53 0.09
54 0.09
55 0.09
56 0.08
57 0.08
58 0.09
59 0.09
60 0.14
61 0.18
62 0.23
63 0.22
64 0.23
65 0.23
66 0.24
67 0.25
68 0.19
69 0.18
70 0.18
71 0.18
72 0.18
73 0.18
74 0.15
75 0.14
76 0.14
77 0.11
78 0.1
79 0.11
80 0.11
81 0.12
82 0.13
83 0.13
84 0.16
85 0.15
86 0.15
87 0.17
88 0.18
89 0.18
90 0.18
91 0.19
92 0.18
93 0.19
94 0.19
95 0.16
96 0.17
97 0.16
98 0.14
99 0.12
100 0.1
101 0.1
102 0.08
103 0.08
104 0.05
105 0.06
106 0.05
107 0.06
108 0.06
109 0.05
110 0.05
111 0.04
112 0.04
113 0.05
114 0.05
115 0.08
116 0.09
117 0.1
118 0.11
119 0.12
120 0.14
121 0.13
122 0.13
123 0.11
124 0.09
125 0.09
126 0.07
127 0.06
128 0.06
129 0.07
130 0.07
131 0.06
132 0.07
133 0.06
134 0.06
135 0.11
136 0.13
137 0.15
138 0.19
139 0.2
140 0.21
141 0.23
142 0.29
143 0.29
144 0.33
145 0.31
146 0.29
147 0.3
148 0.3
149 0.28
150 0.22
151 0.17
152 0.11
153 0.1
154 0.08
155 0.07
156 0.06
157 0.08
158 0.08
159 0.1
160 0.12
161 0.14
162 0.14
163 0.14
164 0.16
165 0.15
166 0.18
167 0.19
168 0.18
169 0.16
170 0.17
171 0.22
172 0.24
173 0.27
174 0.3
175 0.28
176 0.29
177 0.29
178 0.29
179 0.24
180 0.2
181 0.18
182 0.12
183 0.11
184 0.09
185 0.09
186 0.08
187 0.06
188 0.06
189 0.05
190 0.07
191 0.08
192 0.09
193 0.11
194 0.13
195 0.15
196 0.15
197 0.18
198 0.18
199 0.21
200 0.22
201 0.27
202 0.32
203 0.33
204 0.39
205 0.37
206 0.37
207 0.35
208 0.42
209 0.45
210 0.46
211 0.53
212 0.52
213 0.61
214 0.65
215 0.71
216 0.71
217 0.7
218 0.69
219 0.7
220 0.69
221 0.67
222 0.65
223 0.63
224 0.65
225 0.66
226 0.68
227 0.67
228 0.71
229 0.73
230 0.78
231 0.82
232 0.76
233 0.73
234 0.75
235 0.75
236 0.77
237 0.78
238 0.79
239 0.82
240 0.87
241 0.92