Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0U0X2

Protein Details
Accession Q0U0X2    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
160-179DLPPPRYHVRRTKNNNLPIYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007740  Ribosomal_L49/IMG2  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pno:SNOG_14486  -  
Pfam View protein in Pfam  
PF05046  Img2  
Amino Acid Sequences MRGEYVFMIFFTCEEWLTNPTVEPVTSAKPTAPSQAPPAPPTTPQEASRAADLAAAEAVTESDSAQPPEPKPELPSQHGKTPNPTKKADAVSPPTTPTPHPDTQAALKKAPASSQINTLNTKADDIPRPSATSTSKPNTESSLKKPKASTPQKPTLMSIDLPPPRYHVRRTKNNNLPIYTDYKRGGNLHLTTIRKITGDLSQLRDELRVYLNKKEEDAKINTLTQHVIVKGHHPVMVKTFLEQRGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.13
4 0.16
5 0.16
6 0.15
7 0.17
8 0.17
9 0.16
10 0.16
11 0.17
12 0.18
13 0.2
14 0.2
15 0.19
16 0.22
17 0.24
18 0.29
19 0.28
20 0.26
21 0.32
22 0.38
23 0.4
24 0.37
25 0.4
26 0.35
27 0.35
28 0.36
29 0.36
30 0.33
31 0.32
32 0.34
33 0.34
34 0.33
35 0.32
36 0.28
37 0.22
38 0.19
39 0.17
40 0.13
41 0.1
42 0.08
43 0.06
44 0.06
45 0.06
46 0.04
47 0.05
48 0.04
49 0.07
50 0.08
51 0.1
52 0.13
53 0.17
54 0.17
55 0.24
56 0.25
57 0.23
58 0.26
59 0.32
60 0.35
61 0.36
62 0.45
63 0.41
64 0.47
65 0.53
66 0.5
67 0.52
68 0.57
69 0.6
70 0.56
71 0.55
72 0.5
73 0.49
74 0.51
75 0.46
76 0.42
77 0.41
78 0.39
79 0.38
80 0.37
81 0.32
82 0.3
83 0.27
84 0.25
85 0.25
86 0.24
87 0.25
88 0.24
89 0.25
90 0.3
91 0.38
92 0.35
93 0.28
94 0.27
95 0.27
96 0.27
97 0.25
98 0.25
99 0.2
100 0.19
101 0.25
102 0.28
103 0.28
104 0.29
105 0.29
106 0.25
107 0.21
108 0.21
109 0.16
110 0.14
111 0.16
112 0.17
113 0.2
114 0.19
115 0.2
116 0.19
117 0.21
118 0.21
119 0.21
120 0.24
121 0.24
122 0.26
123 0.27
124 0.27
125 0.29
126 0.31
127 0.32
128 0.34
129 0.42
130 0.41
131 0.42
132 0.43
133 0.45
134 0.51
135 0.56
136 0.58
137 0.55
138 0.63
139 0.65
140 0.64
141 0.59
142 0.52
143 0.44
144 0.35
145 0.29
146 0.27
147 0.26
148 0.27
149 0.25
150 0.26
151 0.3
152 0.33
153 0.38
154 0.4
155 0.47
156 0.56
157 0.65
158 0.72
159 0.75
160 0.81
161 0.79
162 0.7
163 0.64
164 0.57
165 0.55
166 0.46
167 0.41
168 0.33
169 0.29
170 0.3
171 0.28
172 0.27
173 0.27
174 0.26
175 0.28
176 0.33
177 0.34
178 0.33
179 0.33
180 0.31
181 0.24
182 0.24
183 0.2
184 0.18
185 0.22
186 0.24
187 0.27
188 0.28
189 0.29
190 0.29
191 0.28
192 0.24
193 0.2
194 0.21
195 0.23
196 0.24
197 0.31
198 0.37
199 0.37
200 0.39
201 0.42
202 0.42
203 0.42
204 0.44
205 0.42
206 0.4
207 0.41
208 0.4
209 0.36
210 0.33
211 0.27
212 0.26
213 0.21
214 0.2
215 0.19
216 0.22
217 0.27
218 0.27
219 0.28
220 0.26
221 0.27
222 0.29
223 0.35
224 0.31
225 0.28
226 0.33