Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2XRI9

Protein Details
Accession G2XRI9    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
126-147CARSNLRWHRHLRRSSQQALRAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, mito_nucl 12, nucl 2.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR037944  PRX5-like  
IPR013740  Redoxin  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0008379  F:thioredoxin peroxidase activity  
GO:0034599  P:cellular response to oxidative stress  
Pfam View protein in Pfam  
PF08534  Redoxin  
Amino Acid Sequences MATRFAIRRLATPHTFRAFSTTRPAFIKVGEKIPNLDTLVENSPANKVNLSELTTGKALIIGVPAAFSPSCSNSHIPGYINHPKLKEAGDVFVVAVNDPFVTKAWGSTLDPTDPFPRRPNRLLHLCARSNLRWHRHLRRSSQQALRAPNRRWKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.48
3 0.43
4 0.45
5 0.39
6 0.35
7 0.41
8 0.35
9 0.33
10 0.35
11 0.38
12 0.31
13 0.32
14 0.37
15 0.3
16 0.34
17 0.36
18 0.34
19 0.33
20 0.34
21 0.34
22 0.27
23 0.25
24 0.19
25 0.18
26 0.19
27 0.19
28 0.17
29 0.15
30 0.16
31 0.17
32 0.17
33 0.14
34 0.12
35 0.13
36 0.15
37 0.17
38 0.17
39 0.16
40 0.17
41 0.17
42 0.16
43 0.13
44 0.12
45 0.09
46 0.06
47 0.06
48 0.04
49 0.04
50 0.04
51 0.04
52 0.05
53 0.05
54 0.05
55 0.06
56 0.08
57 0.1
58 0.12
59 0.14
60 0.14
61 0.15
62 0.16
63 0.16
64 0.15
65 0.2
66 0.26
67 0.28
68 0.29
69 0.28
70 0.27
71 0.28
72 0.28
73 0.24
74 0.17
75 0.15
76 0.13
77 0.13
78 0.12
79 0.12
80 0.11
81 0.08
82 0.07
83 0.06
84 0.05
85 0.05
86 0.05
87 0.04
88 0.06
89 0.06
90 0.06
91 0.07
92 0.1
93 0.11
94 0.14
95 0.16
96 0.16
97 0.17
98 0.19
99 0.25
100 0.26
101 0.28
102 0.33
103 0.39
104 0.44
105 0.48
106 0.53
107 0.54
108 0.59
109 0.62
110 0.62
111 0.62
112 0.58
113 0.57
114 0.56
115 0.5
116 0.5
117 0.54
118 0.52
119 0.53
120 0.59
121 0.66
122 0.7
123 0.76
124 0.76
125 0.78
126 0.8
127 0.81
128 0.8
129 0.78
130 0.74
131 0.76
132 0.77
133 0.75
134 0.73