Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UNW4

Protein Details
Accession Q0UNW4    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
53-74LGSRRERPNRSRSPSHRDRRNDBasic
NLS Segment(s)
PositionSequence
57-67RERPNRSRSPS
Subcellular Location(s) nucl 19, cyto_nucl 12.5, cyto 4, mito 3
Family & Domain DBs
KEGG pno:SNOG_06550  -  
Amino Acid Sequences MVSHRHPPAYWNSYRPSYDGKSHPNPQRDSSPRWSPGLEANSRSVRGSNAVPLGSRRERPNRSRSPSHRDRRNDSYRGHHHDSYRSRREDSYRGRRDDSYRSQSPSPAVTRVHNDNGSKKKEKPELPWPADLDDLMSRTARALDLVVNYERDSDGGLRWAADAIEVIRSEGKKFHSGIANLKAWAGDAERAKAQPTEFEKDVKYARNVCNYVQHMIGRSERNSKGENLYELEKAGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.51
3 0.48
4 0.45
5 0.47
6 0.49
7 0.52
8 0.55
9 0.63
10 0.68
11 0.69
12 0.69
13 0.66
14 0.69
15 0.66
16 0.65
17 0.64
18 0.65
19 0.6
20 0.58
21 0.54
22 0.45
23 0.47
24 0.47
25 0.43
26 0.36
27 0.38
28 0.38
29 0.39
30 0.37
31 0.31
32 0.24
33 0.23
34 0.22
35 0.2
36 0.2
37 0.19
38 0.19
39 0.2
40 0.27
41 0.28
42 0.31
43 0.35
44 0.42
45 0.5
46 0.57
47 0.66
48 0.69
49 0.73
50 0.78
51 0.79
52 0.79
53 0.81
54 0.83
55 0.82
56 0.79
57 0.78
58 0.78
59 0.79
60 0.75
61 0.68
62 0.67
63 0.67
64 0.68
65 0.66
66 0.6
67 0.54
68 0.57
69 0.62
70 0.62
71 0.62
72 0.56
73 0.52
74 0.52
75 0.54
76 0.55
77 0.56
78 0.58
79 0.57
80 0.58
81 0.58
82 0.58
83 0.57
84 0.56
85 0.54
86 0.51
87 0.46
88 0.46
89 0.44
90 0.43
91 0.4
92 0.36
93 0.29
94 0.24
95 0.22
96 0.2
97 0.23
98 0.25
99 0.27
100 0.26
101 0.26
102 0.3
103 0.36
104 0.4
105 0.41
106 0.4
107 0.44
108 0.48
109 0.51
110 0.5
111 0.53
112 0.57
113 0.57
114 0.57
115 0.5
116 0.44
117 0.39
118 0.33
119 0.24
120 0.15
121 0.12
122 0.09
123 0.08
124 0.07
125 0.07
126 0.08
127 0.06
128 0.06
129 0.06
130 0.06
131 0.07
132 0.1
133 0.1
134 0.11
135 0.11
136 0.11
137 0.1
138 0.09
139 0.09
140 0.08
141 0.07
142 0.09
143 0.09
144 0.08
145 0.09
146 0.09
147 0.08
148 0.07
149 0.07
150 0.05
151 0.07
152 0.07
153 0.07
154 0.1
155 0.11
156 0.12
157 0.14
158 0.17
159 0.2
160 0.21
161 0.24
162 0.28
163 0.3
164 0.35
165 0.39
166 0.38
167 0.33
168 0.33
169 0.28
170 0.22
171 0.21
172 0.16
173 0.14
174 0.14
175 0.16
176 0.18
177 0.19
178 0.2
179 0.21
180 0.2
181 0.23
182 0.26
183 0.31
184 0.3
185 0.33
186 0.33
187 0.35
188 0.39
189 0.37
190 0.38
191 0.39
192 0.43
193 0.49
194 0.5
195 0.47
196 0.52
197 0.5
198 0.46
199 0.42
200 0.38
201 0.32
202 0.33
203 0.37
204 0.33
205 0.34
206 0.4
207 0.4
208 0.43
209 0.43
210 0.43
211 0.44
212 0.43
213 0.43
214 0.38
215 0.37
216 0.34