Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2YKF2

Protein Details
Accession G2YKF2    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
70-108RRAAATRHMRRLKKRPREKQEEKEKEKEKEKKPQPHYCMBasic
NLS Segment(s)
PositionSequence
70-102RRAAATRHMRRLKKRPREKQEEKEKEKEKEKKP
Subcellular Location(s) nucl 15, mito 11
Family & Domain DBs
Amino Acid Sequences MYLFTASAGSGGPGVQKYGRTYMDVARETREWNRASEKRRMIGWRREPTPPTTSIRVITGSRKVLIDWLRRAAATRHMRRLKKRPREKQEEKEKEKEKEKKPQPHYCM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.14
4 0.16
5 0.21
6 0.22
7 0.22
8 0.24
9 0.27
10 0.33
11 0.33
12 0.32
13 0.3
14 0.3
15 0.31
16 0.33
17 0.34
18 0.28
19 0.27
20 0.36
21 0.39
22 0.43
23 0.48
24 0.49
25 0.45
26 0.49
27 0.53
28 0.52
29 0.56
30 0.61
31 0.6
32 0.58
33 0.6
34 0.57
35 0.54
36 0.49
37 0.42
38 0.36
39 0.32
40 0.3
41 0.26
42 0.25
43 0.23
44 0.21
45 0.2
46 0.21
47 0.19
48 0.19
49 0.18
50 0.17
51 0.2
52 0.25
53 0.28
54 0.26
55 0.28
56 0.28
57 0.27
58 0.29
59 0.26
60 0.29
61 0.34
62 0.37
63 0.45
64 0.53
65 0.6
66 0.68
67 0.78
68 0.79
69 0.8
70 0.85
71 0.85
72 0.88
73 0.92
74 0.93
75 0.92
76 0.93
77 0.93
78 0.9
79 0.89
80 0.86
81 0.83
82 0.83
83 0.83
84 0.8
85 0.8
86 0.82
87 0.83
88 0.85