Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4R485

Protein Details
Accession C4R485   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
293-314RDAYRDRDRDRDRDRDRRRRRNBasic
NLS Segment(s)
PositionSequence
282-314ERERNRERDRERDAYRDRDRDRDRDRDRRRRRN
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007854  Fip1_dom  
Gene Ontology GO:0005634  C:nucleus  
KEGG ppa:PAS_chr3_0333  -  
Pfam View protein in Pfam  
PF05182  Fip1  
Amino Acid Sequences MDEDDEYLYGSDDEQPQQIGAPETKTASSEKSSTAVKTETGPVSDDEDDNDNSDYSDSDSDIDIVIGALEPSTQPAASTTASSAVPEDNPGENDDAATQVPSAAGKLRIATGSLDVDKVGEYDGKPITQLELQDLKEKPWRLPGSDLADYFNYGFDEFSWSYYCSKQDKTRKEFNPAKLMNELLPAGGFPPSGMPPMPGMPGMPPMPGFMPGMPGMPPMQGMQGMQGMPPMQGMPSMPSMPSMPGMPPMFNNNPANGSSSSSAQQQQAPKRPVNERDSADRERERNRERDRERDAYRDRDRDRDRDRDRRRRRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.17
4 0.18
5 0.19
6 0.19
7 0.18
8 0.18
9 0.19
10 0.2
11 0.21
12 0.21
13 0.21
14 0.21
15 0.22
16 0.22
17 0.22
18 0.23
19 0.26
20 0.25
21 0.27
22 0.24
23 0.22
24 0.22
25 0.27
26 0.25
27 0.24
28 0.24
29 0.22
30 0.25
31 0.25
32 0.23
33 0.19
34 0.21
35 0.2
36 0.2
37 0.2
38 0.15
39 0.14
40 0.14
41 0.12
42 0.11
43 0.11
44 0.1
45 0.1
46 0.1
47 0.1
48 0.1
49 0.09
50 0.07
51 0.06
52 0.05
53 0.04
54 0.04
55 0.03
56 0.03
57 0.03
58 0.05
59 0.06
60 0.06
61 0.06
62 0.07
63 0.1
64 0.1
65 0.11
66 0.1
67 0.12
68 0.12
69 0.12
70 0.12
71 0.1
72 0.1
73 0.1
74 0.12
75 0.11
76 0.12
77 0.13
78 0.14
79 0.13
80 0.13
81 0.11
82 0.1
83 0.09
84 0.08
85 0.07
86 0.05
87 0.06
88 0.05
89 0.06
90 0.07
91 0.08
92 0.08
93 0.09
94 0.1
95 0.1
96 0.1
97 0.1
98 0.1
99 0.11
100 0.11
101 0.1
102 0.09
103 0.09
104 0.08
105 0.08
106 0.07
107 0.07
108 0.06
109 0.1
110 0.1
111 0.1
112 0.1
113 0.1
114 0.11
115 0.11
116 0.11
117 0.12
118 0.16
119 0.17
120 0.22
121 0.23
122 0.23
123 0.27
124 0.28
125 0.25
126 0.29
127 0.3
128 0.26
129 0.28
130 0.31
131 0.32
132 0.33
133 0.33
134 0.25
135 0.24
136 0.23
137 0.2
138 0.15
139 0.09
140 0.07
141 0.07
142 0.05
143 0.1
144 0.09
145 0.1
146 0.11
147 0.12
148 0.13
149 0.15
150 0.19
151 0.17
152 0.21
153 0.28
154 0.36
155 0.45
156 0.5
157 0.59
158 0.58
159 0.65
160 0.69
161 0.65
162 0.67
163 0.58
164 0.53
165 0.45
166 0.42
167 0.33
168 0.26
169 0.21
170 0.11
171 0.09
172 0.07
173 0.06
174 0.06
175 0.05
176 0.04
177 0.05
178 0.06
179 0.07
180 0.07
181 0.07
182 0.08
183 0.09
184 0.1
185 0.09
186 0.09
187 0.08
188 0.11
189 0.11
190 0.1
191 0.1
192 0.1
193 0.1
194 0.11
195 0.12
196 0.08
197 0.1
198 0.1
199 0.11
200 0.1
201 0.1
202 0.1
203 0.09
204 0.1
205 0.08
206 0.08
207 0.08
208 0.08
209 0.08
210 0.1
211 0.1
212 0.09
213 0.1
214 0.09
215 0.09
216 0.09
217 0.08
218 0.06
219 0.06
220 0.07
221 0.08
222 0.1
223 0.11
224 0.11
225 0.12
226 0.13
227 0.13
228 0.13
229 0.12
230 0.1
231 0.16
232 0.17
233 0.16
234 0.17
235 0.23
236 0.25
237 0.3
238 0.32
239 0.27
240 0.28
241 0.28
242 0.3
243 0.24
244 0.25
245 0.2
246 0.2
247 0.2
248 0.22
249 0.25
250 0.23
251 0.28
252 0.32
253 0.4
254 0.48
255 0.52
256 0.53
257 0.56
258 0.62
259 0.66
260 0.64
261 0.63
262 0.57
263 0.6
264 0.63
265 0.61
266 0.61
267 0.59
268 0.58
269 0.59
270 0.64
271 0.63
272 0.65
273 0.7
274 0.73
275 0.73
276 0.77
277 0.78
278 0.77
279 0.75
280 0.75
281 0.73
282 0.72
283 0.75
284 0.75
285 0.71
286 0.72
287 0.74
288 0.74
289 0.74
290 0.75
291 0.76
292 0.77
293 0.84
294 0.85