Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2YIK5

Protein Details
Accession G2YIK5    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
48-78SSSRHRQKTSKLFRISKRQRRKEVRIGVVELHydrophilic
NLS Segment(s)
PositionSequence
55-69KTSKLFRISKRQRRK
Subcellular Location(s) mito 16.5, cyto_mito 10.5, cyto 3.5, nucl 3, plas 2
Family & Domain DBs
Amino Acid Sequences MICCQFGPARCGDHMFFLVGSAIRSSLRSQFLSYHISPKTFVTRGWISSSRHRQKTSKLFRISKRQRRKEVRIGVVELLLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.21
3 0.18
4 0.15
5 0.15
6 0.12
7 0.11
8 0.08
9 0.08
10 0.07
11 0.09
12 0.1
13 0.14
14 0.17
15 0.17
16 0.18
17 0.19
18 0.22
19 0.27
20 0.26
21 0.27
22 0.24
23 0.24
24 0.23
25 0.23
26 0.25
27 0.19
28 0.19
29 0.19
30 0.19
31 0.2
32 0.25
33 0.28
34 0.26
35 0.35
36 0.46
37 0.49
38 0.54
39 0.57
40 0.56
41 0.61
42 0.69
43 0.7
44 0.69
45 0.7
46 0.72
47 0.75
48 0.83
49 0.84
50 0.84
51 0.85
52 0.85
53 0.87
54 0.89
55 0.91
56 0.9
57 0.89
58 0.87
59 0.82
60 0.75
61 0.66