Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YH30

Protein Details
Accession G2YH30   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
89-113LTAYITPRRRLWKKREKITWMPGAAHydrophilic
NLS Segment(s)
PositionSequence
100-103WKKR
Subcellular Location(s) mito 19, nucl 3, plas 2, cyto_pero 2, cyto 1.5, pero 1.5
Family & Domain DBs
Amino Acid Sequences MCQRSSLGHPLSQSTTGLLPLGNNDTLTGLWETDLASALVNNGLPRIPGNKLRYEGINAEYGEHANWLFPDWMRVNSKTGEMWFNIVPLTAYITPRRRLWKKREKITWMPGAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.17
4 0.16
5 0.13
6 0.09
7 0.1
8 0.13
9 0.12
10 0.11
11 0.11
12 0.11
13 0.11
14 0.13
15 0.11
16 0.08
17 0.07
18 0.08
19 0.08
20 0.07
21 0.08
22 0.06
23 0.05
24 0.05
25 0.05
26 0.05
27 0.06
28 0.05
29 0.05
30 0.05
31 0.05
32 0.06
33 0.08
34 0.1
35 0.17
36 0.2
37 0.23
38 0.25
39 0.26
40 0.26
41 0.26
42 0.25
43 0.19
44 0.2
45 0.16
46 0.15
47 0.14
48 0.14
49 0.11
50 0.1
51 0.08
52 0.05
53 0.05
54 0.06
55 0.06
56 0.06
57 0.11
58 0.11
59 0.16
60 0.19
61 0.21
62 0.22
63 0.22
64 0.23
65 0.2
66 0.21
67 0.2
68 0.16
69 0.18
70 0.16
71 0.15
72 0.14
73 0.12
74 0.11
75 0.08
76 0.13
77 0.12
78 0.14
79 0.22
80 0.27
81 0.32
82 0.37
83 0.47
84 0.52
85 0.6
86 0.69
87 0.72
88 0.77
89 0.84
90 0.89
91 0.88
92 0.88
93 0.87