Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UGV2

Protein Details
Accession Q0UGV2    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
26-46GSYANKKRAIRKNTSFHRPKTHydrophilic
NLS Segment(s)
PositionSequence
29-45ANKKRAIRKNTSFHRPK
Subcellular Location(s) mito 14, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR005633  Ribosomal_L23/L25_N  
IPR013025  Ribosomal_L25/23  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000027  P:ribosomal large subunit assembly  
GO:0006412  P:translation  
KEGG pno:SNOG_09012  -  
Pfam View protein in Pfam  
PF00276  Ribosomal_L23  
PF03939  Ribosomal_L23eN  
Amino Acid Sequences MGPKATTKTTKTGKQANAAAKSALRGSYANKKRAIRKNTSFHRPKTLQLSRAPKYPRKSVPHEPRMDASKVLIHPLNTESAMKKIEENNTLVFIVDVKANKRQIAAALKKQYDVSCVKINTLIRPDGSKKAFARLTADVDALDIAATKLAIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.67
3 0.66
4 0.63
5 0.57
6 0.51
7 0.42
8 0.38
9 0.32
10 0.26
11 0.19
12 0.15
13 0.19
14 0.28
15 0.35
16 0.4
17 0.45
18 0.5
19 0.58
20 0.67
21 0.71
22 0.7
23 0.71
24 0.75
25 0.77
26 0.82
27 0.8
28 0.74
29 0.75
30 0.67
31 0.63
32 0.63
33 0.6
34 0.55
35 0.55
36 0.6
37 0.53
38 0.58
39 0.59
40 0.55
41 0.54
42 0.57
43 0.58
44 0.56
45 0.61
46 0.65
47 0.7
48 0.73
49 0.71
50 0.64
51 0.58
52 0.56
53 0.49
54 0.38
55 0.28
56 0.22
57 0.19
58 0.19
59 0.17
60 0.13
61 0.13
62 0.13
63 0.14
64 0.1
65 0.11
66 0.1
67 0.1
68 0.11
69 0.11
70 0.12
71 0.14
72 0.18
73 0.19
74 0.2
75 0.19
76 0.19
77 0.19
78 0.17
79 0.14
80 0.1
81 0.08
82 0.09
83 0.09
84 0.1
85 0.16
86 0.18
87 0.18
88 0.18
89 0.18
90 0.21
91 0.3
92 0.34
93 0.37
94 0.43
95 0.43
96 0.43
97 0.45
98 0.4
99 0.36
100 0.32
101 0.28
102 0.28
103 0.28
104 0.27
105 0.3
106 0.31
107 0.31
108 0.32
109 0.3
110 0.24
111 0.29
112 0.32
113 0.36
114 0.37
115 0.39
116 0.36
117 0.42
118 0.43
119 0.4
120 0.41
121 0.36
122 0.39
123 0.33
124 0.33
125 0.24
126 0.22
127 0.21
128 0.15
129 0.11
130 0.07
131 0.05
132 0.05