Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YK43

Protein Details
Accession G2YK43    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
44-67DDGSGSQRPRRRRRKCPVDEAGEQBasic
NLS Segment(s)
PositionSequence
51-57RPRRRRR
Subcellular Location(s) mito 9, plas 5, cyto_mito 5, mito_nucl 5, extr 4, E.R. 4
Family & Domain DBs
Amino Acid Sequences MPPHLHPRSRFTSSLFAGTLFASFFVVALPHVLPCPAPRVVYADDGSGSQRPRRRRRKCPVDEAGEQGKEQGQLQMQLKTVGGAREGKSEYKDFNEKIREEMGGSSGESDDGEEMEGSRNLAKRECPVPKPGGVLGGILGFKSSVGENASKPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.39
3 0.32
4 0.27
5 0.25
6 0.21
7 0.13
8 0.11
9 0.07
10 0.07
11 0.06
12 0.05
13 0.05
14 0.05
15 0.07
16 0.07
17 0.06
18 0.07
19 0.07
20 0.08
21 0.08
22 0.13
23 0.12
24 0.13
25 0.13
26 0.17
27 0.19
28 0.22
29 0.22
30 0.18
31 0.17
32 0.17
33 0.18
34 0.17
35 0.17
36 0.18
37 0.23
38 0.32
39 0.43
40 0.54
41 0.62
42 0.7
43 0.79
44 0.86
45 0.89
46 0.89
47 0.86
48 0.82
49 0.74
50 0.68
51 0.61
52 0.5
53 0.42
54 0.32
55 0.25
56 0.18
57 0.16
58 0.13
59 0.09
60 0.13
61 0.14
62 0.16
63 0.15
64 0.15
65 0.15
66 0.14
67 0.14
68 0.1
69 0.1
70 0.11
71 0.11
72 0.14
73 0.16
74 0.17
75 0.18
76 0.19
77 0.19
78 0.2
79 0.25
80 0.22
81 0.27
82 0.32
83 0.3
84 0.31
85 0.31
86 0.27
87 0.22
88 0.22
89 0.17
90 0.12
91 0.11
92 0.1
93 0.08
94 0.08
95 0.07
96 0.07
97 0.06
98 0.05
99 0.05
100 0.05
101 0.05
102 0.07
103 0.08
104 0.08
105 0.11
106 0.13
107 0.15
108 0.17
109 0.19
110 0.21
111 0.3
112 0.37
113 0.37
114 0.42
115 0.45
116 0.45
117 0.46
118 0.42
119 0.36
120 0.29
121 0.25
122 0.19
123 0.17
124 0.15
125 0.11
126 0.11
127 0.08
128 0.07
129 0.08
130 0.08
131 0.08
132 0.11
133 0.14