Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2XQ69

Protein Details
Accession G2XQ69    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-29VPKRLVRTSHREAKRRFKASQRQLPLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 8.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MRYVPKRLVRTSHREAKRRFKASQRQLPLLLKLPPPLAAIARDIPISEKHACTFMRSNTFADVALSKGNRSSFDNQGTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.77
3 0.79
4 0.81
5 0.78
6 0.75
7 0.75
8 0.77
9 0.78
10 0.8
11 0.75
12 0.69
13 0.67
14 0.64
15 0.56
16 0.48
17 0.41
18 0.32
19 0.27
20 0.24
21 0.2
22 0.19
23 0.16
24 0.14
25 0.11
26 0.11
27 0.1
28 0.11
29 0.09
30 0.09
31 0.1
32 0.1
33 0.14
34 0.14
35 0.14
36 0.14
37 0.18
38 0.18
39 0.21
40 0.25
41 0.25
42 0.3
43 0.31
44 0.32
45 0.3
46 0.3
47 0.26
48 0.23
49 0.19
50 0.13
51 0.16
52 0.15
53 0.14
54 0.17
55 0.18
56 0.19
57 0.24
58 0.28
59 0.31