Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YNU5

Protein Details
Accession G2YNU5    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
80-102KEEKRQNMLRRRHTEKGDKTRKCBasic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MSYNDHLCKPNAYPPTCPFRKEEIKHLERKCVRCLKREGFFITNESHQNAKTRRLSEAAEIRKGTILTLKRLEQAEEFVKEEKRQNMLRRRHTEKGDKTRKCVIM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.53
3 0.52
4 0.51
5 0.48
6 0.48
7 0.56
8 0.53
9 0.57
10 0.58
11 0.62
12 0.7
13 0.67
14 0.69
15 0.66
16 0.66
17 0.65
18 0.64
19 0.61
20 0.59
21 0.66
22 0.63
23 0.61
24 0.62
25 0.58
26 0.5
27 0.47
28 0.42
29 0.35
30 0.3
31 0.26
32 0.23
33 0.19
34 0.17
35 0.22
36 0.22
37 0.27
38 0.29
39 0.29
40 0.29
41 0.3
42 0.3
43 0.29
44 0.36
45 0.32
46 0.31
47 0.3
48 0.29
49 0.28
50 0.27
51 0.22
52 0.19
53 0.17
54 0.18
55 0.21
56 0.22
57 0.25
58 0.26
59 0.27
60 0.22
61 0.24
62 0.24
63 0.22
64 0.23
65 0.22
66 0.24
67 0.26
68 0.31
69 0.31
70 0.33
71 0.38
72 0.46
73 0.53
74 0.61
75 0.68
76 0.72
77 0.76
78 0.77
79 0.79
80 0.8
81 0.81
82 0.83
83 0.83
84 0.8
85 0.78