Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Y4L6

Protein Details
Accession G2Y4L6    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
56-81NRTWIESRIDRCKRRKPSLNENDWSPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 6.5, cyto_mito 4.5, golg 2, cysk 2, mito 1.5
Family & Domain DBs
Amino Acid Sequences MNNIMMMGIHEVLLELFKEVRTLLHCVARSTAGFVIILSFGENLTFGTENMAGSSNRTWIESRIDRCKRRKPSLNENDWSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.06
5 0.07
6 0.07
7 0.08
8 0.1
9 0.14
10 0.16
11 0.2
12 0.21
13 0.22
14 0.23
15 0.23
16 0.2
17 0.19
18 0.16
19 0.11
20 0.1
21 0.09
22 0.09
23 0.07
24 0.07
25 0.05
26 0.04
27 0.04
28 0.04
29 0.04
30 0.03
31 0.05
32 0.05
33 0.05
34 0.06
35 0.07
36 0.07
37 0.07
38 0.09
39 0.08
40 0.09
41 0.1
42 0.11
43 0.11
44 0.13
45 0.14
46 0.14
47 0.22
48 0.27
49 0.33
50 0.41
51 0.51
52 0.58
53 0.66
54 0.75
55 0.77
56 0.81
57 0.85
58 0.83
59 0.85
60 0.87
61 0.88