Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2Y3N2

Protein Details
Accession G2Y3N2    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
156-180IEVVQRKAKRARRARLTYMRKPKHDBasic
NLS Segment(s)
PositionSequence
161-172RKAKRARRARLT
204-217ERRQTSKKKTKGKK
Subcellular Location(s) mito 20, nucl 4, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038657  L19_sf  
IPR001857  Ribosomal_L19  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01245  Ribosomal_L19  
Amino Acid Sequences MATMTPTLRPLSCWKSLLRQSRQQKTISRSLTTYHNSKPASQTPLQTQAVRKIKTYPPPSSPAQVFKEPIKNLHAEQIAVLDPTGARTNLFSKTNPEAARVGDILLIRLKTGDPFAGVCINIRRRGVETGILLRNELTRVGVEMWYKIYSPNVEGIEVVQRKAKRARRARLTYMRKPKHDMGSVQNIVLQYQRTRGVLGRSEGERRQTSKKKTKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.44
3 0.52
4 0.59
5 0.59
6 0.63
7 0.68
8 0.75
9 0.78
10 0.74
11 0.74
12 0.7
13 0.72
14 0.67
15 0.59
16 0.5
17 0.48
18 0.49
19 0.46
20 0.45
21 0.39
22 0.42
23 0.4
24 0.41
25 0.45
26 0.44
27 0.46
28 0.43
29 0.43
30 0.41
31 0.48
32 0.48
33 0.45
34 0.41
35 0.44
36 0.5
37 0.47
38 0.43
39 0.41
40 0.44
41 0.51
42 0.55
43 0.51
44 0.47
45 0.51
46 0.53
47 0.52
48 0.48
49 0.45
50 0.43
51 0.4
52 0.38
53 0.37
54 0.42
55 0.38
56 0.38
57 0.34
58 0.31
59 0.28
60 0.32
61 0.28
62 0.2
63 0.2
64 0.18
65 0.16
66 0.13
67 0.12
68 0.06
69 0.05
70 0.07
71 0.08
72 0.07
73 0.06
74 0.08
75 0.1
76 0.14
77 0.16
78 0.14
79 0.18
80 0.21
81 0.27
82 0.26
83 0.26
84 0.23
85 0.22
86 0.23
87 0.18
88 0.15
89 0.11
90 0.11
91 0.09
92 0.1
93 0.09
94 0.07
95 0.08
96 0.07
97 0.06
98 0.07
99 0.06
100 0.05
101 0.06
102 0.07
103 0.07
104 0.07
105 0.08
106 0.13
107 0.16
108 0.18
109 0.18
110 0.18
111 0.19
112 0.21
113 0.22
114 0.19
115 0.18
116 0.21
117 0.23
118 0.22
119 0.2
120 0.19
121 0.18
122 0.16
123 0.14
124 0.09
125 0.06
126 0.07
127 0.08
128 0.1
129 0.1
130 0.1
131 0.12
132 0.12
133 0.12
134 0.11
135 0.12
136 0.11
137 0.12
138 0.16
139 0.14
140 0.14
141 0.14
142 0.14
143 0.21
144 0.2
145 0.2
146 0.2
147 0.2
148 0.25
149 0.34
150 0.41
151 0.43
152 0.53
153 0.62
154 0.68
155 0.76
156 0.81
157 0.83
158 0.85
159 0.85
160 0.86
161 0.84
162 0.78
163 0.77
164 0.74
165 0.71
166 0.68
167 0.62
168 0.58
169 0.6
170 0.57
171 0.5
172 0.45
173 0.36
174 0.31
175 0.29
176 0.24
177 0.15
178 0.18
179 0.21
180 0.19
181 0.21
182 0.24
183 0.28
184 0.31
185 0.33
186 0.34
187 0.35
188 0.4
189 0.42
190 0.46
191 0.46
192 0.45
193 0.53
194 0.57
195 0.65
196 0.69
197 0.76