Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2YMV5

Protein Details
Accession G2YMV5    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MDESTLSKREKKRLRFFKKFGSRCTHydrophilic
NLS Segment(s)
PositionSequence
9-15REKKRLR
Subcellular Location(s) nucl 19, mito 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MDESTLSKREKKRLRFFKKFGSRCTIPKPWSEAGTAAAGLRDAGQMTEEAKREIETYQKVRCKCQNWRLSSHRCGEGGIEDTRRLYEPNDYDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.87
3 0.86
4 0.87
5 0.88
6 0.83
7 0.78
8 0.76
9 0.69
10 0.64
11 0.66
12 0.63
13 0.54
14 0.53
15 0.53
16 0.46
17 0.44
18 0.39
19 0.31
20 0.25
21 0.23
22 0.19
23 0.13
24 0.1
25 0.08
26 0.07
27 0.06
28 0.05
29 0.04
30 0.04
31 0.04
32 0.04
33 0.05
34 0.08
35 0.09
36 0.09
37 0.09
38 0.1
39 0.1
40 0.11
41 0.15
42 0.17
43 0.21
44 0.28
45 0.34
46 0.35
47 0.4
48 0.47
49 0.49
50 0.54
51 0.59
52 0.61
53 0.61
54 0.68
55 0.71
56 0.72
57 0.71
58 0.67
59 0.6
60 0.52
61 0.47
62 0.4
63 0.34
64 0.29
65 0.26
66 0.23
67 0.2
68 0.21
69 0.22
70 0.22
71 0.2
72 0.18
73 0.23