Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F0UNH6

Protein Details
Accession F0UNH6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
46-67LQEVKRTSTRRCRWKSYRCCCSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MTRVSIVSLPAQHPEEAKRLIDRQKRGATSARHMSAERSLMSQLQLQEVKRTSTRRCRWKSYRCCCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.25
4 0.25
5 0.25
6 0.28
7 0.37
8 0.42
9 0.44
10 0.48
11 0.52
12 0.52
13 0.51
14 0.52
15 0.46
16 0.45
17 0.47
18 0.4
19 0.35
20 0.34
21 0.32
22 0.27
23 0.26
24 0.2
25 0.14
26 0.13
27 0.12
28 0.13
29 0.14
30 0.13
31 0.15
32 0.18
33 0.17
34 0.22
35 0.23
36 0.25
37 0.28
38 0.33
39 0.37
40 0.46
41 0.55
42 0.61
43 0.67
44 0.74
45 0.8
46 0.85
47 0.88