Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F0UC09

Protein Details
Accession F0UC09    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
15-44DSLEKAKRQSGTRRGKKRRKRGAHAQTGVRBasic
NLS Segment(s)
PositionSequence
13-37GRDSLEKAKRQSGTRRGKKRRKRGA
Subcellular Location(s) nucl 8.5cyto_nucl 8.5, cyto 7.5, mito 6, pero 2
Family & Domain DBs
Amino Acid Sequences MGRSTISRRERDGRDSLEKAKRQSGTRRGKKRRKRGAHAQTGVRERDAAGLLDEAEDVVVVDVVVIIIDASKGDGAVTGRVLLSVRDCNSPQLEAQLQPAEHRTRGGARLRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.59
3 0.61
4 0.62
5 0.61
6 0.58
7 0.58
8 0.56
9 0.54
10 0.59
11 0.61
12 0.63
13 0.69
14 0.77
15 0.81
16 0.87
17 0.91
18 0.92
19 0.93
20 0.92
21 0.91
22 0.91
23 0.9
24 0.9
25 0.85
26 0.8
27 0.75
28 0.69
29 0.61
30 0.5
31 0.39
32 0.28
33 0.24
34 0.19
35 0.13
36 0.09
37 0.08
38 0.07
39 0.07
40 0.07
41 0.05
42 0.04
43 0.03
44 0.03
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.03
61 0.04
62 0.05
63 0.06
64 0.06
65 0.06
66 0.06
67 0.07
68 0.07
69 0.07
70 0.09
71 0.13
72 0.15
73 0.18
74 0.19
75 0.22
76 0.24
77 0.25
78 0.22
79 0.23
80 0.24
81 0.21
82 0.24
83 0.25
84 0.23
85 0.24
86 0.29
87 0.28
88 0.26
89 0.26
90 0.26
91 0.27
92 0.34