Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0UA81

Protein Details
Accession F0UA81    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
23-46RTGENKTKSPKKENIRHPNKIWKAHydrophilic
NLS Segment(s)
PositionSequence
30-34KSPKK
Subcellular Location(s) nucl 15, cyto_nucl 11.5, cyto 6, mito 5
Family & Domain DBs
Amino Acid Sequences MAQHTMINRTRPIKGLAKQGTQRTGENKTKSPKKENIRHPNKIWKANAAYQGQGVRGITTTTTSRETRKVGLLSQLHRSVAEKVRQEQGTRSKEQGARNKEQGRKGSLDEAIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.5
3 0.5
4 0.54
5 0.58
6 0.61
7 0.61
8 0.55
9 0.54
10 0.48
11 0.5
12 0.51
13 0.49
14 0.5
15 0.54
16 0.6
17 0.63
18 0.67
19 0.67
20 0.69
21 0.74
22 0.79
23 0.8
24 0.81
25 0.82
26 0.79
27 0.81
28 0.77
29 0.75
30 0.65
31 0.59
32 0.53
33 0.5
34 0.51
35 0.42
36 0.35
37 0.3
38 0.29
39 0.23
40 0.2
41 0.15
42 0.09
43 0.08
44 0.07
45 0.06
46 0.07
47 0.07
48 0.09
49 0.12
50 0.14
51 0.16
52 0.19
53 0.21
54 0.22
55 0.25
56 0.24
57 0.22
58 0.28
59 0.3
60 0.29
61 0.33
62 0.33
63 0.29
64 0.28
65 0.28
66 0.26
67 0.28
68 0.32
69 0.3
70 0.32
71 0.39
72 0.41
73 0.41
74 0.42
75 0.46
76 0.46
77 0.46
78 0.45
79 0.46
80 0.49
81 0.56
82 0.58
83 0.57
84 0.58
85 0.64
86 0.71
87 0.7
88 0.72
89 0.7
90 0.66
91 0.62
92 0.58
93 0.54