Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UBV3

Protein Details
Accession Q0UBV3    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
13-40GLKLKGTGVDKKKKKKRPKPAEDAAESABasic
NLS Segment(s)
PositionSequence
19-33TGVDKKKKKKRPKPA
66-104KSMKEAGGRKKTEAERRHDEMRRKRLEERLKREGVKTHK
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Gene Ontology GO:0005730  C:nucleolus  
KEGG pno:SNOG_10761  -  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPSSDYTTAIGGGLKLKGTGVDKKKKKKRPKPAEDAAESASTDVAKRAKSPSQTPGRSLSPDAAEKSMKEAGGRKKTEAERRHDEMRRKRLEERLKREGVKTHKEKVEELNKYLSGLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.12
5 0.15
6 0.24
7 0.31
8 0.41
9 0.5
10 0.61
11 0.71
12 0.79
13 0.87
14 0.88
15 0.9
16 0.91
17 0.93
18 0.92
19 0.92
20 0.9
21 0.82
22 0.74
23 0.65
24 0.54
25 0.43
26 0.33
27 0.23
28 0.14
29 0.11
30 0.11
31 0.11
32 0.1
33 0.12
34 0.16
35 0.2
36 0.23
37 0.27
38 0.33
39 0.41
40 0.42
41 0.43
42 0.43
43 0.41
44 0.39
45 0.36
46 0.29
47 0.21
48 0.22
49 0.2
50 0.18
51 0.16
52 0.14
53 0.16
54 0.16
55 0.14
56 0.13
57 0.18
58 0.25
59 0.33
60 0.34
61 0.33
62 0.38
63 0.44
64 0.52
65 0.53
66 0.52
67 0.51
68 0.55
69 0.62
70 0.62
71 0.65
72 0.66
73 0.69
74 0.69
75 0.66
76 0.66
77 0.67
78 0.72
79 0.73
80 0.72
81 0.71
82 0.7
83 0.68
84 0.66
85 0.65
86 0.62
87 0.62
88 0.6
89 0.59
90 0.57
91 0.56
92 0.56
93 0.57
94 0.59
95 0.53
96 0.5
97 0.47
98 0.43
99 0.41
100 0.39
101 0.3
102 0.22
103 0.18
104 0.19
105 0.18
106 0.19
107 0.21
108 0.24
109 0.24