Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F0UVN8

Protein Details
Accession F0UVN8    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
114-140KLYSLRCYQKRFKGKKGREPERIQCTVHydrophilic
NLS Segment(s)
PositionSequence
126-130KGKKG
Subcellular Location(s) mito 22, extr 2, nucl 1, cyto 1, plas 1, cyto_nucl 1
Family & Domain DBs
Amino Acid Sequences MGWLAGFLLTVLNISMLRIHETVFSALRLWVIIVPDGGASSGGRHCWCQYEGMAKTGGADWSGVDVDTFSRLCEYALFTKLHNPPSFRLVNCESPSTKATEIAKTKQNKTNKTKLYSLRCYQKRFKGKKGREPERIQCTVQHSPHIPQLASLTLEYKKVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.08
3 0.09
4 0.12
5 0.12
6 0.13
7 0.14
8 0.15
9 0.18
10 0.16
11 0.16
12 0.13
13 0.13
14 0.13
15 0.11
16 0.1
17 0.09
18 0.09
19 0.09
20 0.08
21 0.08
22 0.07
23 0.07
24 0.07
25 0.06
26 0.05
27 0.06
28 0.07
29 0.09
30 0.1
31 0.12
32 0.12
33 0.16
34 0.16
35 0.17
36 0.17
37 0.23
38 0.23
39 0.24
40 0.23
41 0.19
42 0.19
43 0.18
44 0.17
45 0.09
46 0.08
47 0.06
48 0.06
49 0.06
50 0.06
51 0.05
52 0.04
53 0.05
54 0.06
55 0.06
56 0.05
57 0.06
58 0.06
59 0.06
60 0.07
61 0.09
62 0.1
63 0.13
64 0.13
65 0.13
66 0.2
67 0.24
68 0.29
69 0.28
70 0.27
71 0.26
72 0.31
73 0.34
74 0.26
75 0.29
76 0.27
77 0.31
78 0.31
79 0.32
80 0.27
81 0.27
82 0.28
83 0.26
84 0.22
85 0.2
86 0.21
87 0.25
88 0.28
89 0.3
90 0.36
91 0.39
92 0.45
93 0.47
94 0.53
95 0.56
96 0.61
97 0.67
98 0.67
99 0.66
100 0.68
101 0.7
102 0.71
103 0.69
104 0.69
105 0.69
106 0.69
107 0.71
108 0.72
109 0.73
110 0.75
111 0.74
112 0.78
113 0.78
114 0.81
115 0.84
116 0.87
117 0.87
118 0.86
119 0.88
120 0.86
121 0.84
122 0.78
123 0.69
124 0.63
125 0.6
126 0.59
127 0.52
128 0.49
129 0.43
130 0.42
131 0.46
132 0.46
133 0.38
134 0.3
135 0.31
136 0.27
137 0.25
138 0.22
139 0.21
140 0.18