Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F0UC57

Protein Details
Accession F0UC57    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
13-32SIPASTSKAKPKPERLPITVHydrophilic
200-229RGEGRRERVERIKRNERRMRANERRAGRAKBasic
NLS Segment(s)
PositionSequence
121-149ELFARKKGIGKYNKKLGSGGGSAEAERRK
191-230GLSREGKGIRGEGRRERVERIKRNERRMRANERRAGRAKE
Subcellular Location(s) mito 20.5, cyto_mito 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MAIADMVGSTSTSIPASTSKAKPKPERLPITVEKPTPYTFDLGHLLALDPNPLILSNDTSLNAALTATARDGAQSLLNQLLTTCTITSTTRDGILLSLPPRTTLLPRFKPLPAPKQPTKWELFARKKGIGKYNKKLGSGGGSAEAERRKKLVYDEASGEWVPRWGYKGKNKGGENDWLVEVDEKVWKKEEGLSREGKGIRGEGRRERVERIKRNERRMRANERRAGRAKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.15
4 0.22
5 0.28
6 0.37
7 0.44
8 0.54
9 0.62
10 0.7
11 0.75
12 0.78
13 0.8
14 0.74
15 0.76
16 0.73
17 0.71
18 0.67
19 0.59
20 0.51
21 0.46
22 0.44
23 0.38
24 0.33
25 0.27
26 0.21
27 0.22
28 0.23
29 0.2
30 0.19
31 0.16
32 0.15
33 0.14
34 0.13
35 0.1
36 0.07
37 0.07
38 0.07
39 0.07
40 0.07
41 0.07
42 0.09
43 0.1
44 0.11
45 0.12
46 0.12
47 0.12
48 0.1
49 0.09
50 0.07
51 0.06
52 0.05
53 0.05
54 0.05
55 0.06
56 0.06
57 0.06
58 0.06
59 0.07
60 0.08
61 0.07
62 0.08
63 0.09
64 0.09
65 0.09
66 0.08
67 0.08
68 0.08
69 0.08
70 0.07
71 0.06
72 0.08
73 0.09
74 0.1
75 0.12
76 0.12
77 0.12
78 0.12
79 0.11
80 0.1
81 0.1
82 0.11
83 0.09
84 0.11
85 0.1
86 0.1
87 0.11
88 0.12
89 0.14
90 0.19
91 0.27
92 0.29
93 0.31
94 0.34
95 0.34
96 0.41
97 0.44
98 0.46
99 0.46
100 0.49
101 0.51
102 0.55
103 0.58
104 0.55
105 0.52
106 0.46
107 0.44
108 0.46
109 0.5
110 0.5
111 0.51
112 0.5
113 0.51
114 0.51
115 0.54
116 0.54
117 0.55
118 0.55
119 0.6
120 0.59
121 0.56
122 0.52
123 0.45
124 0.39
125 0.31
126 0.24
127 0.17
128 0.14
129 0.13
130 0.16
131 0.19
132 0.17
133 0.17
134 0.17
135 0.16
136 0.17
137 0.2
138 0.25
139 0.25
140 0.27
141 0.3
142 0.29
143 0.31
144 0.3
145 0.27
146 0.18
147 0.16
148 0.13
149 0.11
150 0.13
151 0.14
152 0.22
153 0.3
154 0.4
155 0.45
156 0.53
157 0.54
158 0.57
159 0.56
160 0.56
161 0.49
162 0.42
163 0.36
164 0.28
165 0.27
166 0.22
167 0.18
168 0.12
169 0.16
170 0.15
171 0.16
172 0.18
173 0.18
174 0.18
175 0.25
176 0.32
177 0.32
178 0.37
179 0.4
180 0.39
181 0.45
182 0.45
183 0.4
184 0.34
185 0.32
186 0.33
187 0.35
188 0.41
189 0.43
190 0.5
191 0.55
192 0.56
193 0.59
194 0.63
195 0.67
196 0.7
197 0.71
198 0.75
199 0.77
200 0.85
201 0.88
202 0.86
203 0.86
204 0.86
205 0.87
206 0.87
207 0.88
208 0.85
209 0.81
210 0.83