Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F0U6T3

Protein Details
Accession F0U6T3    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
23-43LVSPHRTKRPWQGQQEAPSKTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001937  GalP_UDPtransf1  
IPR019779  GalP_UDPtransf1_His-AS  
IPR005850  GalP_Utransf_C  
IPR005849  GalP_Utransf_N  
IPR036265  HIT-like_sf  
Gene Ontology GO:0008108  F:UDP-glucose:hexose-1-phosphate uridylyltransferase activity  
GO:0008270  F:zinc ion binding  
GO:0033499  P:galactose catabolic process via UDP-galactose  
Pfam View protein in Pfam  
PF02744  GalP_UDP_tr_C  
PF01087  GalP_UDP_transf  
PROSITE View protein in PROSITE  
PS00117  GAL_P_UDP_TRANSF_I  
CDD cd00608  GalT  
Amino Acid Sequences MVESVLDDISHRRYNILRGSYVLVSPHRTKRPWQGQQEAPSKTELPVYDPACYLCPGNQRAQGDQNPQYKNTFIFLNDYSAVKEEQAAYQQESVDGDLSSVFLQAESVTGRCYVLTFSASHNRTLADLSPAEIKPIIDAWTDLYVSHLSPTSPLAATASLMPISPGSPMSQISLPKHQLRYMQIFENKGSAMGCSNPHPHGQVWALSCLPEELTIELAQLQKYRHENHGKHMLQDYATLELQKQERVVFENDLFLVLCPWWATWPFETMIVSKRHRRALVDLTTAEKFLLAESIAEITRRYDNLFETHFPYSMGIHQAPLCGSDEEIDASHLHIHFYPPLLRSASVRKFLVGPCTATKCWRNPNGTSHLSKQLFDSGVVLGLCIALD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.41
3 0.43
4 0.38
5 0.36
6 0.4
7 0.38
8 0.37
9 0.34
10 0.28
11 0.3
12 0.36
13 0.43
14 0.46
15 0.48
16 0.53
17 0.61
18 0.68
19 0.72
20 0.74
21 0.74
22 0.74
23 0.81
24 0.83
25 0.75
26 0.65
27 0.58
28 0.5
29 0.42
30 0.38
31 0.28
32 0.24
33 0.29
34 0.29
35 0.28
36 0.27
37 0.28
38 0.25
39 0.25
40 0.21
41 0.18
42 0.25
43 0.26
44 0.32
45 0.36
46 0.37
47 0.4
48 0.46
49 0.49
50 0.48
51 0.53
52 0.55
53 0.53
54 0.52
55 0.5
56 0.44
57 0.39
58 0.33
59 0.26
60 0.19
61 0.21
62 0.2
63 0.22
64 0.22
65 0.21
66 0.2
67 0.19
68 0.19
69 0.14
70 0.15
71 0.12
72 0.12
73 0.16
74 0.18
75 0.18
76 0.19
77 0.19
78 0.18
79 0.17
80 0.16
81 0.13
82 0.1
83 0.09
84 0.07
85 0.07
86 0.07
87 0.07
88 0.06
89 0.05
90 0.05
91 0.05
92 0.06
93 0.06
94 0.06
95 0.07
96 0.07
97 0.07
98 0.07
99 0.08
100 0.07
101 0.08
102 0.09
103 0.09
104 0.13
105 0.22
106 0.23
107 0.24
108 0.23
109 0.22
110 0.22
111 0.22
112 0.19
113 0.13
114 0.12
115 0.13
116 0.17
117 0.17
118 0.17
119 0.16
120 0.15
121 0.12
122 0.13
123 0.13
124 0.08
125 0.09
126 0.09
127 0.1
128 0.1
129 0.1
130 0.1
131 0.09
132 0.09
133 0.1
134 0.08
135 0.07
136 0.08
137 0.09
138 0.09
139 0.08
140 0.08
141 0.08
142 0.08
143 0.08
144 0.08
145 0.08
146 0.06
147 0.06
148 0.06
149 0.05
150 0.05
151 0.05
152 0.06
153 0.06
154 0.07
155 0.07
156 0.09
157 0.11
158 0.14
159 0.16
160 0.21
161 0.25
162 0.28
163 0.29
164 0.29
165 0.31
166 0.32
167 0.35
168 0.32
169 0.33
170 0.32
171 0.32
172 0.3
173 0.28
174 0.23
175 0.18
176 0.16
177 0.1
178 0.08
179 0.08
180 0.08
181 0.1
182 0.13
183 0.13
184 0.14
185 0.16
186 0.15
187 0.16
188 0.17
189 0.17
190 0.15
191 0.16
192 0.15
193 0.13
194 0.13
195 0.1
196 0.09
197 0.07
198 0.06
199 0.05
200 0.06
201 0.06
202 0.06
203 0.08
204 0.09
205 0.09
206 0.11
207 0.11
208 0.14
209 0.18
210 0.21
211 0.28
212 0.37
213 0.37
214 0.41
215 0.52
216 0.48
217 0.46
218 0.45
219 0.38
220 0.29
221 0.29
222 0.24
223 0.16
224 0.16
225 0.14
226 0.12
227 0.14
228 0.15
229 0.14
230 0.14
231 0.12
232 0.13
233 0.16
234 0.18
235 0.17
236 0.17
237 0.17
238 0.16
239 0.15
240 0.14
241 0.11
242 0.09
243 0.06
244 0.06
245 0.05
246 0.05
247 0.07
248 0.08
249 0.1
250 0.1
251 0.13
252 0.13
253 0.14
254 0.15
255 0.15
256 0.19
257 0.24
258 0.27
259 0.33
260 0.38
261 0.43
262 0.44
263 0.45
264 0.46
265 0.48
266 0.5
267 0.46
268 0.42
269 0.39
270 0.37
271 0.35
272 0.28
273 0.2
274 0.14
275 0.09
276 0.09
277 0.06
278 0.05
279 0.06
280 0.08
281 0.08
282 0.08
283 0.08
284 0.1
285 0.12
286 0.13
287 0.14
288 0.14
289 0.16
290 0.19
291 0.23
292 0.23
293 0.25
294 0.26
295 0.25
296 0.23
297 0.22
298 0.19
299 0.18
300 0.21
301 0.17
302 0.17
303 0.18
304 0.19
305 0.18
306 0.18
307 0.18
308 0.13
309 0.12
310 0.11
311 0.12
312 0.12
313 0.12
314 0.12
315 0.09
316 0.1
317 0.13
318 0.12
319 0.13
320 0.13
321 0.15
322 0.15
323 0.18
324 0.21
325 0.19
326 0.23
327 0.24
328 0.24
329 0.25
330 0.34
331 0.38
332 0.4
333 0.39
334 0.37
335 0.39
336 0.4
337 0.44
338 0.37
339 0.34
340 0.34
341 0.4
342 0.4
343 0.43
344 0.48
345 0.48
346 0.56
347 0.6
348 0.6
349 0.59
350 0.66
351 0.67
352 0.68
353 0.65
354 0.61
355 0.62
356 0.58
357 0.53
358 0.47
359 0.45
360 0.39
361 0.34
362 0.3
363 0.2
364 0.21
365 0.2
366 0.18
367 0.11