Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0UV82

Protein Details
Accession F0UV82   
Localization Confidence High
Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
280-312EAPKKPVPGSKRKRAPFPPKPRKKGGRIEIEYEBasic
NLS Segment(s)
PositionSequence
137-161EKLVAKLAPKVRRREETRERKAEAA
282-306PKKPVPGSKRKRAPFPPKPRKKGGR
Subcellular Location(s) nucl 21, mito 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029004  L28e/Mak16  
IPR006958  Mak16  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF04874  Mak16  
PF01778  Ribosomal_L28e  
Amino Acid Sequences MSSDEIVWQVINQQFCSYKLKTTKGQNFCRNEYNVTGLCNRQSCPLANSRYATVRSDPATGAMYLYMKTIERSHMPSKWWERIRLSSNYAKALEQLDERLIYWPKFLIHKCKQRLTRLTQVSIRTRKLIKEEERLGEKLVAKLAPKVRRREETRERKAEAAAKVERAIERELIERLRSGAYGDRPLNVEEGIWKKVLRGLERQGEGERDEDLDEGIEEEEEEEEGVGEVEYVSDIDEEDDDLEDMEDWLGGDSAEEEEEDDDHDDDESNDNSEESSEADEAPKKPVPGSKRKRAPFPPKPRKKGGRIEIEYETEGPSKEGIYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.33
4 0.28
5 0.33
6 0.38
7 0.44
8 0.48
9 0.57
10 0.65
11 0.68
12 0.77
13 0.78
14 0.77
15 0.77
16 0.77
17 0.69
18 0.63
19 0.55
20 0.51
21 0.43
22 0.39
23 0.37
24 0.32
25 0.34
26 0.32
27 0.31
28 0.29
29 0.31
30 0.3
31 0.31
32 0.37
33 0.37
34 0.39
35 0.4
36 0.38
37 0.41
38 0.4
39 0.39
40 0.33
41 0.32
42 0.3
43 0.3
44 0.27
45 0.23
46 0.23
47 0.2
48 0.17
49 0.14
50 0.12
51 0.11
52 0.11
53 0.1
54 0.09
55 0.11
56 0.12
57 0.14
58 0.17
59 0.23
60 0.28
61 0.3
62 0.32
63 0.4
64 0.45
65 0.51
66 0.52
67 0.52
68 0.51
69 0.55
70 0.59
71 0.55
72 0.54
73 0.51
74 0.49
75 0.47
76 0.43
77 0.36
78 0.32
79 0.28
80 0.24
81 0.19
82 0.17
83 0.14
84 0.14
85 0.14
86 0.16
87 0.18
88 0.16
89 0.15
90 0.15
91 0.16
92 0.22
93 0.24
94 0.3
95 0.37
96 0.46
97 0.52
98 0.59
99 0.64
100 0.68
101 0.73
102 0.69
103 0.7
104 0.65
105 0.63
106 0.59
107 0.58
108 0.58
109 0.56
110 0.5
111 0.45
112 0.42
113 0.4
114 0.41
115 0.44
116 0.41
117 0.43
118 0.46
119 0.46
120 0.47
121 0.46
122 0.41
123 0.36
124 0.31
125 0.23
126 0.21
127 0.18
128 0.14
129 0.19
130 0.24
131 0.29
132 0.34
133 0.4
134 0.44
135 0.51
136 0.56
137 0.61
138 0.66
139 0.69
140 0.72
141 0.72
142 0.68
143 0.61
144 0.58
145 0.54
146 0.44
147 0.39
148 0.3
149 0.25
150 0.24
151 0.24
152 0.22
153 0.18
154 0.17
155 0.12
156 0.12
157 0.13
158 0.13
159 0.13
160 0.13
161 0.11
162 0.11
163 0.1
164 0.09
165 0.09
166 0.11
167 0.12
168 0.17
169 0.18
170 0.17
171 0.18
172 0.19
173 0.19
174 0.15
175 0.13
176 0.12
177 0.14
178 0.14
179 0.14
180 0.14
181 0.13
182 0.16
183 0.19
184 0.18
185 0.21
186 0.25
187 0.31
188 0.32
189 0.33
190 0.32
191 0.3
192 0.28
193 0.23
194 0.18
195 0.12
196 0.11
197 0.1
198 0.08
199 0.07
200 0.06
201 0.06
202 0.06
203 0.05
204 0.04
205 0.04
206 0.04
207 0.04
208 0.04
209 0.03
210 0.04
211 0.04
212 0.04
213 0.03
214 0.03
215 0.03
216 0.03
217 0.03
218 0.03
219 0.03
220 0.03
221 0.04
222 0.04
223 0.04
224 0.05
225 0.05
226 0.06
227 0.05
228 0.05
229 0.06
230 0.05
231 0.05
232 0.05
233 0.05
234 0.04
235 0.05
236 0.04
237 0.04
238 0.04
239 0.04
240 0.05
241 0.05
242 0.05
243 0.05
244 0.05
245 0.06
246 0.07
247 0.08
248 0.08
249 0.08
250 0.08
251 0.08
252 0.09
253 0.12
254 0.11
255 0.11
256 0.11
257 0.11
258 0.11
259 0.11
260 0.1
261 0.08
262 0.1
263 0.09
264 0.1
265 0.13
266 0.18
267 0.18
268 0.24
269 0.25
270 0.24
271 0.26
272 0.32
273 0.38
274 0.45
275 0.54
276 0.59
277 0.67
278 0.72
279 0.8
280 0.84
281 0.86
282 0.86
283 0.88
284 0.88
285 0.9
286 0.92
287 0.92
288 0.92
289 0.9
290 0.9
291 0.88
292 0.88
293 0.82
294 0.79
295 0.73
296 0.67
297 0.59
298 0.49
299 0.42
300 0.32
301 0.28
302 0.23
303 0.19