Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0UAZ1

Protein Details
Accession F0UAZ1   
Localization Confidence Low
Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
94-120RCMAKPVSPTPQKRRTIRKRNETSMSNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MKARPLRLLLRLPQLFFSNYACAPSTHLELPEQAEVGSLQDYQLPTTIPAPHSPGPNKPPPPSGPSQNFEERQLESRHACSRSQTKKTPYSSARCMAKPVSPTPQKRRTIRKRNETSMSNWELAPVAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.38
3 0.33
4 0.3
5 0.23
6 0.2
7 0.21
8 0.2
9 0.17
10 0.19
11 0.2
12 0.21
13 0.19
14 0.2
15 0.18
16 0.19
17 0.21
18 0.19
19 0.16
20 0.12
21 0.11
22 0.1
23 0.1
24 0.09
25 0.07
26 0.06
27 0.08
28 0.08
29 0.08
30 0.09
31 0.08
32 0.08
33 0.1
34 0.13
35 0.12
36 0.13
37 0.18
38 0.2
39 0.24
40 0.25
41 0.29
42 0.32
43 0.39
44 0.42
45 0.39
46 0.41
47 0.38
48 0.41
49 0.39
50 0.41
51 0.38
52 0.36
53 0.39
54 0.4
55 0.38
56 0.35
57 0.34
58 0.28
59 0.27
60 0.26
61 0.24
62 0.2
63 0.23
64 0.26
65 0.26
66 0.25
67 0.27
68 0.35
69 0.41
70 0.47
71 0.51
72 0.53
73 0.59
74 0.62
75 0.66
76 0.64
77 0.62
78 0.6
79 0.61
80 0.59
81 0.51
82 0.51
83 0.44
84 0.41
85 0.38
86 0.36
87 0.39
88 0.42
89 0.51
90 0.57
91 0.65
92 0.7
93 0.74
94 0.81
95 0.83
96 0.85
97 0.87
98 0.88
99 0.88
100 0.88
101 0.87
102 0.8
103 0.75
104 0.73
105 0.67
106 0.57
107 0.47
108 0.39
109 0.32