Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F0UNH1

Protein Details
Accession F0UNH1    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
65-87QAIRSRYGPKPPKPPSRPPPANSHydrophilic
NLS Segment(s)
PositionSequence
75-78PPKP
Subcellular Location(s) nucl 17, cyto_nucl 11.5, mito 6, cyto 4
Family & Domain DBs
Amino Acid Sequences MKKPNKKTHKQYEETIPQPSAHPHRSSSPCPAQADPMLSLAISHQSISNSERDRQTPDKIELPLQAIRSRYGPKPPKPPSRPPPANSDGVGMGNPRGRVSEVATADRSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.67
3 0.57
4 0.47
5 0.43
6 0.43
7 0.4
8 0.36
9 0.36
10 0.34
11 0.41
12 0.46
13 0.48
14 0.5
15 0.5
16 0.5
17 0.5
18 0.48
19 0.43
20 0.39
21 0.37
22 0.29
23 0.23
24 0.17
25 0.14
26 0.13
27 0.1
28 0.1
29 0.08
30 0.07
31 0.07
32 0.07
33 0.09
34 0.11
35 0.16
36 0.16
37 0.19
38 0.2
39 0.21
40 0.26
41 0.28
42 0.31
43 0.29
44 0.3
45 0.3
46 0.29
47 0.3
48 0.25
49 0.25
50 0.24
51 0.22
52 0.21
53 0.19
54 0.19
55 0.2
56 0.23
57 0.22
58 0.3
59 0.37
60 0.42
61 0.52
62 0.61
63 0.69
64 0.73
65 0.81
66 0.79
67 0.81
68 0.83
69 0.74
70 0.74
71 0.68
72 0.64
73 0.54
74 0.47
75 0.37
76 0.29
77 0.27
78 0.19
79 0.17
80 0.17
81 0.17
82 0.15
83 0.15
84 0.16
85 0.17
86 0.21
87 0.25
88 0.26
89 0.29