Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F0UNH7

Protein Details
Accession F0UNH7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
23-51RGWVFLQPKHKPKPKIKHKHKPLISPDHTBasic
NLS Segment(s)
PositionSequence
31-44KHKPKPKIKHKHKP
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
Amino Acid Sequences MTWTPYPAATKQGRAPASLQMVRGWVFLQPKHKPKPKIKHKHKPLISPDHTPVPLCRVPEAGASVPKSVRPTEPWFAANGLAVAAFFGACCHRGYSPASSFPRAVKSALCPKEEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.37
4 0.42
5 0.39
6 0.34
7 0.27
8 0.28
9 0.26
10 0.25
11 0.19
12 0.15
13 0.17
14 0.19
15 0.27
16 0.33
17 0.41
18 0.51
19 0.58
20 0.65
21 0.71
22 0.8
23 0.82
24 0.86
25 0.88
26 0.89
27 0.92
28 0.93
29 0.88
30 0.86
31 0.83
32 0.82
33 0.75
34 0.69
35 0.6
36 0.54
37 0.49
38 0.4
39 0.32
40 0.27
41 0.25
42 0.2
43 0.18
44 0.15
45 0.15
46 0.15
47 0.17
48 0.12
49 0.14
50 0.14
51 0.15
52 0.14
53 0.15
54 0.16
55 0.15
56 0.16
57 0.18
58 0.24
59 0.26
60 0.28
61 0.28
62 0.26
63 0.26
64 0.24
65 0.19
66 0.13
67 0.09
68 0.07
69 0.06
70 0.04
71 0.04
72 0.03
73 0.03
74 0.04
75 0.05
76 0.06
77 0.07
78 0.09
79 0.09
80 0.12
81 0.16
82 0.22
83 0.25
84 0.33
85 0.37
86 0.38
87 0.4
88 0.4
89 0.43
90 0.38
91 0.35
92 0.29
93 0.32
94 0.4
95 0.44