Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F0U9K2

Protein Details
Accession F0U9K2    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
37-57LSHLSWKRRAGRKYGNRDGDGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 11.5, cyto 8.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR025714  Methyltranfer_dom  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
Pfam View protein in Pfam  
PF13847  Methyltransf_31  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MMSVPAQAGGVDDHPPHLEPSQLGTKEYWESFYENSLSHLSWKRRAGRKYGNRDGDGDANGRAKEEEEEEDEEREGECDEDNDSDEDGGEDGDDDDDSDPGTSWFAEHNAPEKVLRFLTSESFPLAPCNTHNNGNKNNNTQPQPQPQPQPQPQPQPQPQPQPQPQPTILDLGTGNGSMLALLRDEGGFTGGQMVGVDYSSKSIELARRLHHGSAGRGRDGEGDGYGGGDRIGADTTTTATSTIRFEVWDVFDKRAVEELDWFPVARGGFDIVLDKGTFDAISLSAEEIAVDVRTVGEPGKKRGEEEEEENVDTKESRVVQRMCERYPEIVRGLEGGGRERRRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.18
4 0.17
5 0.18
6 0.16
7 0.21
8 0.29
9 0.28
10 0.29
11 0.27
12 0.29
13 0.32
14 0.32
15 0.29
16 0.22
17 0.24
18 0.23
19 0.26
20 0.25
21 0.2
22 0.22
23 0.21
24 0.19
25 0.24
26 0.31
27 0.33
28 0.39
29 0.46
30 0.53
31 0.6
32 0.65
33 0.68
34 0.71
35 0.76
36 0.79
37 0.81
38 0.8
39 0.73
40 0.71
41 0.64
42 0.57
43 0.49
44 0.39
45 0.32
46 0.27
47 0.25
48 0.23
49 0.2
50 0.17
51 0.16
52 0.17
53 0.17
54 0.17
55 0.21
56 0.22
57 0.23
58 0.22
59 0.21
60 0.18
61 0.16
62 0.12
63 0.09
64 0.08
65 0.07
66 0.08
67 0.08
68 0.1
69 0.1
70 0.1
71 0.1
72 0.09
73 0.09
74 0.08
75 0.07
76 0.05
77 0.04
78 0.04
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.06
85 0.06
86 0.06
87 0.06
88 0.06
89 0.05
90 0.05
91 0.06
92 0.08
93 0.09
94 0.1
95 0.14
96 0.14
97 0.15
98 0.16
99 0.16
100 0.17
101 0.16
102 0.16
103 0.14
104 0.14
105 0.16
106 0.16
107 0.16
108 0.15
109 0.16
110 0.14
111 0.15
112 0.14
113 0.12
114 0.12
115 0.18
116 0.18
117 0.26
118 0.31
119 0.35
120 0.43
121 0.5
122 0.52
123 0.52
124 0.55
125 0.53
126 0.52
127 0.52
128 0.5
129 0.51
130 0.53
131 0.53
132 0.53
133 0.54
134 0.59
135 0.59
136 0.62
137 0.59
138 0.62
139 0.62
140 0.65
141 0.65
142 0.65
143 0.65
144 0.65
145 0.65
146 0.65
147 0.65
148 0.65
149 0.62
150 0.58
151 0.53
152 0.46
153 0.41
154 0.34
155 0.28
156 0.2
157 0.17
158 0.12
159 0.11
160 0.08
161 0.07
162 0.05
163 0.05
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.03
170 0.03
171 0.04
172 0.04
173 0.05
174 0.04
175 0.04
176 0.05
177 0.05
178 0.05
179 0.05
180 0.05
181 0.04
182 0.04
183 0.05
184 0.03
185 0.05
186 0.05
187 0.05
188 0.05
189 0.08
190 0.11
191 0.16
192 0.19
193 0.2
194 0.25
195 0.27
196 0.27
197 0.28
198 0.27
199 0.26
200 0.3
201 0.31
202 0.27
203 0.25
204 0.26
205 0.24
206 0.22
207 0.18
208 0.11
209 0.09
210 0.08
211 0.08
212 0.07
213 0.06
214 0.05
215 0.04
216 0.04
217 0.04
218 0.05
219 0.04
220 0.05
221 0.05
222 0.06
223 0.07
224 0.07
225 0.07
226 0.07
227 0.08
228 0.09
229 0.1
230 0.09
231 0.09
232 0.1
233 0.12
234 0.15
235 0.22
236 0.22
237 0.23
238 0.25
239 0.25
240 0.25
241 0.26
242 0.24
243 0.17
244 0.2
245 0.2
246 0.2
247 0.2
248 0.2
249 0.15
250 0.17
251 0.17
252 0.12
253 0.11
254 0.09
255 0.09
256 0.1
257 0.11
258 0.09
259 0.1
260 0.1
261 0.09
262 0.08
263 0.08
264 0.08
265 0.06
266 0.07
267 0.06
268 0.07
269 0.07
270 0.07
271 0.07
272 0.07
273 0.07
274 0.06
275 0.06
276 0.05
277 0.05
278 0.04
279 0.05
280 0.06
281 0.06
282 0.08
283 0.14
284 0.18
285 0.24
286 0.34
287 0.34
288 0.35
289 0.4
290 0.45
291 0.44
292 0.46
293 0.49
294 0.43
295 0.44
296 0.43
297 0.38
298 0.31
299 0.27
300 0.22
301 0.18
302 0.19
303 0.22
304 0.3
305 0.32
306 0.39
307 0.48
308 0.54
309 0.51
310 0.54
311 0.53
312 0.5
313 0.53
314 0.5
315 0.43
316 0.38
317 0.36
318 0.31
319 0.29
320 0.24
321 0.2
322 0.22
323 0.28