Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0UDA6

Protein Details
Accession F0UDA6   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MVCAIPYRNQHPRRKYEQRRQGEEERGGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MVCAIPYRNQHPRRKYEQRRQGEEERGGTDEDEMLKKLKLTINIRGEETWKEESKGRWAVTMTQCVMFADGAVVVDYVSVSSSNSEGCVDLGQQKCVGISNLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.86
3 0.87
4 0.88
5 0.88
6 0.87
7 0.86
8 0.83
9 0.8
10 0.74
11 0.65
12 0.56
13 0.47
14 0.39
15 0.32
16 0.24
17 0.17
18 0.14
19 0.12
20 0.11
21 0.11
22 0.11
23 0.11
24 0.13
25 0.15
26 0.2
27 0.23
28 0.31
29 0.36
30 0.37
31 0.38
32 0.35
33 0.34
34 0.28
35 0.28
36 0.23
37 0.18
38 0.18
39 0.19
40 0.19
41 0.24
42 0.27
43 0.24
44 0.22
45 0.22
46 0.28
47 0.28
48 0.32
49 0.26
50 0.22
51 0.22
52 0.21
53 0.21
54 0.13
55 0.1
56 0.06
57 0.05
58 0.05
59 0.04
60 0.04
61 0.03
62 0.04
63 0.03
64 0.03
65 0.04
66 0.04
67 0.04
68 0.05
69 0.06
70 0.06
71 0.07
72 0.08
73 0.07
74 0.08
75 0.08
76 0.09
77 0.17
78 0.18
79 0.19
80 0.19
81 0.19
82 0.19
83 0.2