Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0UEE9

Protein Details
Accession F0UEE9   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
21-47PLISLEPRKRARWRRRTQRSNPADHSGHydrophilic
NLS Segment(s)
PositionSequence
28-38RKRARWRRRTQ
Subcellular Location(s) extr 12, nucl 5, mito 5, mito_nucl 5
Family & Domain DBs
Amino Acid Sequences MPACLPACLIISFLVQRSADPLISLEPRKRARWRRRTQRSNPADHSGRSSRLRFSRCYAYLGMRLPGTCPGLVIPLDLGPLRSWGAVGPLDVGCPTRITAPSRIWRTAAGRVSKRPMVRSLQRTWLAGSGSSGKKNIPTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.14
4 0.16
5 0.17
6 0.15
7 0.14
8 0.14
9 0.14
10 0.19
11 0.23
12 0.24
13 0.31
14 0.35
15 0.42
16 0.52
17 0.59
18 0.65
19 0.72
20 0.8
21 0.83
22 0.89
23 0.93
24 0.93
25 0.93
26 0.9
27 0.88
28 0.82
29 0.78
30 0.7
31 0.6
32 0.56
33 0.48
34 0.46
35 0.41
36 0.38
37 0.36
38 0.39
39 0.42
40 0.38
41 0.39
42 0.42
43 0.39
44 0.4
45 0.35
46 0.31
47 0.32
48 0.3
49 0.27
50 0.19
51 0.18
52 0.15
53 0.16
54 0.14
55 0.1
56 0.09
57 0.08
58 0.09
59 0.09
60 0.08
61 0.06
62 0.05
63 0.06
64 0.06
65 0.06
66 0.05
67 0.06
68 0.07
69 0.06
70 0.06
71 0.06
72 0.08
73 0.07
74 0.07
75 0.08
76 0.07
77 0.08
78 0.08
79 0.09
80 0.07
81 0.08
82 0.08
83 0.09
84 0.12
85 0.15
86 0.2
87 0.26
88 0.34
89 0.38
90 0.39
91 0.38
92 0.39
93 0.39
94 0.42
95 0.42
96 0.42
97 0.42
98 0.46
99 0.51
100 0.53
101 0.53
102 0.49
103 0.48
104 0.48
105 0.53
106 0.55
107 0.54
108 0.58
109 0.57
110 0.55
111 0.51
112 0.46
113 0.37
114 0.3
115 0.28
116 0.27
117 0.28
118 0.29
119 0.29
120 0.27