Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F0UNL4

Protein Details
Accession F0UNL4    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
88-111LATAQAKRNIRRREARGRKACGVGHydrophilic
NLS Segment(s)
PositionSequence
94-106KRNIRRREARGRK
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MSRALKAFGEKVSNNSKQLAKLFKEAAAGSRLLPSRTSKNDEEYQCRIDIGEEVKDNPGYYNVYLQVNSQARSEGLKDWLKKNPHGNLATAQAKRNIRRREARGRKACGVGTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.41
4 0.38
5 0.43
6 0.45
7 0.39
8 0.4
9 0.39
10 0.36
11 0.36
12 0.32
13 0.29
14 0.24
15 0.21
16 0.16
17 0.19
18 0.19
19 0.17
20 0.19
21 0.2
22 0.24
23 0.29
24 0.34
25 0.31
26 0.36
27 0.43
28 0.45
29 0.47
30 0.44
31 0.42
32 0.36
33 0.34
34 0.28
35 0.21
36 0.19
37 0.14
38 0.13
39 0.11
40 0.11
41 0.12
42 0.12
43 0.12
44 0.1
45 0.1
46 0.09
47 0.08
48 0.09
49 0.1
50 0.11
51 0.11
52 0.11
53 0.17
54 0.18
55 0.19
56 0.17
57 0.16
58 0.16
59 0.17
60 0.18
61 0.12
62 0.17
63 0.21
64 0.24
65 0.28
66 0.35
67 0.38
68 0.42
69 0.48
70 0.48
71 0.51
72 0.49
73 0.47
74 0.43
75 0.46
76 0.48
77 0.42
78 0.38
79 0.37
80 0.42
81 0.48
82 0.55
83 0.56
84 0.58
85 0.65
86 0.72
87 0.76
88 0.81
89 0.84
90 0.85
91 0.84
92 0.81
93 0.76