Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0UBQ2

Protein Details
Accession F0UBQ2   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
115-145TFRWRLQEARFRKQSRRKRREYISQQNIPPYHydrophilic
NLS Segment(s)
PositionSequence
125-134FRKQSRRKRR
Subcellular Location(s) mito 21, cyto 2.5, cyto_nucl 2.5, nucl 1.5
Family & Domain DBs
Amino Acid Sequences MTLTCASGRRLCPFRWLSVSGSRRDGQWGRRILFGVPRARNSGSMAATVIRCVDVDEPVRGTELSSRRLAPTTGFFQPSTCHYYGVSGDRERTSMAKQWPGEGGVRVRCPRGLVTFRWRLQEARFRKQSRRKRREYISQQNIPPYGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.46
3 0.46
4 0.42
5 0.47
6 0.51
7 0.45
8 0.47
9 0.42
10 0.37
11 0.42
12 0.43
13 0.39
14 0.43
15 0.46
16 0.43
17 0.44
18 0.44
19 0.38
20 0.4
21 0.4
22 0.41
23 0.37
24 0.38
25 0.39
26 0.39
27 0.39
28 0.35
29 0.33
30 0.25
31 0.22
32 0.2
33 0.17
34 0.16
35 0.15
36 0.13
37 0.08
38 0.07
39 0.08
40 0.08
41 0.09
42 0.1
43 0.11
44 0.12
45 0.12
46 0.12
47 0.11
48 0.11
49 0.14
50 0.15
51 0.18
52 0.18
53 0.19
54 0.19
55 0.2
56 0.2
57 0.16
58 0.16
59 0.16
60 0.17
61 0.18
62 0.17
63 0.17
64 0.17
65 0.19
66 0.22
67 0.19
68 0.17
69 0.15
70 0.17
71 0.18
72 0.21
73 0.21
74 0.16
75 0.18
76 0.18
77 0.18
78 0.18
79 0.18
80 0.16
81 0.19
82 0.22
83 0.26
84 0.26
85 0.27
86 0.27
87 0.27
88 0.26
89 0.23
90 0.23
91 0.21
92 0.27
93 0.27
94 0.27
95 0.26
96 0.26
97 0.26
98 0.29
99 0.3
100 0.3
101 0.37
102 0.45
103 0.47
104 0.5
105 0.49
106 0.44
107 0.47
108 0.51
109 0.5
110 0.51
111 0.59
112 0.6
113 0.69
114 0.77
115 0.81
116 0.83
117 0.86
118 0.85
119 0.86
120 0.89
121 0.9
122 0.9
123 0.91
124 0.9
125 0.87
126 0.82
127 0.79