Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0U4S5

Protein Details
Accession Q0U4S5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAQLHRPKARRKSTTQKISEVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 22, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004254  AdipoR/HlyIII-related  
Gene Ontology GO:0016020  C:membrane  
GO:0038023  F:signaling receptor activity  
GO:0006882  P:intracellular zinc ion homeostasis  
KEGG pno:SNOG_13239  -  
Pfam View protein in Pfam  
PF03006  HlyIII  
Amino Acid Sequences MAQLHRPKARRKSTTQKISEVIQSTKRLLFTFDEVEAWQRDNEYLCGNYRTKSNSYRASLKSMLYLHNQTGNIYSHLVGAVLFLAYSTNVYDKITTRYSTADVFDLLAFGVFISSAIICFGISATFHIFGNHSSKVYHTWLMLDLYGIFVLIAGVLDHVFGWGKITVSGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.83
3 0.78
4 0.71
5 0.66
6 0.62
7 0.55
8 0.49
9 0.44
10 0.42
11 0.39
12 0.38
13 0.36
14 0.3
15 0.29
16 0.27
17 0.24
18 0.24
19 0.22
20 0.21
21 0.19
22 0.22
23 0.2
24 0.19
25 0.15
26 0.13
27 0.13
28 0.14
29 0.15
30 0.14
31 0.14
32 0.16
33 0.2
34 0.2
35 0.2
36 0.22
37 0.25
38 0.27
39 0.31
40 0.35
41 0.38
42 0.41
43 0.48
44 0.47
45 0.48
46 0.46
47 0.4
48 0.38
49 0.32
50 0.3
51 0.26
52 0.26
53 0.21
54 0.23
55 0.22
56 0.19
57 0.2
58 0.18
59 0.16
60 0.14
61 0.14
62 0.1
63 0.1
64 0.09
65 0.07
66 0.05
67 0.04
68 0.03
69 0.03
70 0.02
71 0.03
72 0.03
73 0.03
74 0.03
75 0.04
76 0.04
77 0.05
78 0.06
79 0.07
80 0.11
81 0.13
82 0.13
83 0.14
84 0.15
85 0.16
86 0.16
87 0.16
88 0.13
89 0.11
90 0.11
91 0.1
92 0.08
93 0.07
94 0.06
95 0.04
96 0.04
97 0.03
98 0.02
99 0.02
100 0.03
101 0.03
102 0.03
103 0.03
104 0.04
105 0.03
106 0.04
107 0.04
108 0.04
109 0.04
110 0.06
111 0.07
112 0.08
113 0.09
114 0.09
115 0.1
116 0.12
117 0.16
118 0.16
119 0.15
120 0.14
121 0.16
122 0.19
123 0.22
124 0.22
125 0.18
126 0.18
127 0.19
128 0.2
129 0.18
130 0.15
131 0.11
132 0.1
133 0.1
134 0.08
135 0.06
136 0.05
137 0.04
138 0.04
139 0.04
140 0.03
141 0.04
142 0.04
143 0.04
144 0.04
145 0.05
146 0.06
147 0.06
148 0.08
149 0.09
150 0.09