Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0UC55

Protein Details
Accession F0UC55    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
45-67RITTRPYKPKCTRAQRSQSNPAPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MHVYIYQNTYQHVRSNPLPGGVLISLETYPPFSCRLLPDNARKIRITTRPYKPKCTRAQRSQSNPAPVNNDTTFRYDFDSTRHSQIHTATLPNRAGLFRLLPGQSALNIVREEVLKQKGNQDLEDELAPKRHGAVAPETDTGMTEKGDDRQLRETA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.38
3 0.37
4 0.35
5 0.33
6 0.27
7 0.27
8 0.22
9 0.19
10 0.12
11 0.12
12 0.1
13 0.1
14 0.1
15 0.09
16 0.09
17 0.1
18 0.12
19 0.11
20 0.13
21 0.17
22 0.21
23 0.26
24 0.33
25 0.41
26 0.48
27 0.52
28 0.53
29 0.5
30 0.49
31 0.5
32 0.51
33 0.49
34 0.48
35 0.54
36 0.62
37 0.66
38 0.74
39 0.73
40 0.74
41 0.78
42 0.79
43 0.79
44 0.78
45 0.84
46 0.82
47 0.83
48 0.83
49 0.78
50 0.75
51 0.67
52 0.58
53 0.52
54 0.44
55 0.41
56 0.32
57 0.29
58 0.23
59 0.24
60 0.23
61 0.19
62 0.21
63 0.17
64 0.17
65 0.17
66 0.21
67 0.2
68 0.23
69 0.23
70 0.2
71 0.21
72 0.21
73 0.23
74 0.19
75 0.21
76 0.18
77 0.22
78 0.22
79 0.21
80 0.21
81 0.16
82 0.16
83 0.14
84 0.13
85 0.09
86 0.12
87 0.12
88 0.11
89 0.12
90 0.12
91 0.11
92 0.13
93 0.13
94 0.11
95 0.11
96 0.11
97 0.11
98 0.11
99 0.12
100 0.15
101 0.2
102 0.21
103 0.22
104 0.27
105 0.32
106 0.34
107 0.33
108 0.3
109 0.26
110 0.25
111 0.26
112 0.22
113 0.17
114 0.18
115 0.18
116 0.15
117 0.15
118 0.16
119 0.16
120 0.18
121 0.23
122 0.26
123 0.3
124 0.3
125 0.3
126 0.26
127 0.25
128 0.24
129 0.18
130 0.12
131 0.11
132 0.12
133 0.15
134 0.23
135 0.25
136 0.27