Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0ULZ4

Protein Details
Accession F0ULZ4    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
201-222DPMTSKRTWNNKRKEEENGDKTHydrophilic
NLS Segment(s)
PositionSequence
34-36KKK
Subcellular Location(s) nucl 13, mito_nucl 10.833, cyto_nucl 8.833, mito 7.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MQERVPNIRQGIGLPSRQGKYGLQSDISENERGKKKIKGVEDIPRRNEIGQDRRKHASALFFDTLDSDLKSSLLISYVVCSDENCRGEQPKSLNPHTTQLQPSRTGFDHSSSCDVEWERNRRVWFDRAPLPLTEHVVAWFYSGFPCPGKQSTCKYTFRFDLTPWAKQAWAQVNSVYIHVGPITSSRYATRNKTNKGHSIIDPMTSKRTWNNKRKEEENGDKTLSINTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.36
3 0.35
4 0.36
5 0.36
6 0.3
7 0.32
8 0.35
9 0.34
10 0.3
11 0.3
12 0.31
13 0.33
14 0.34
15 0.32
16 0.27
17 0.32
18 0.37
19 0.38
20 0.4
21 0.42
22 0.46
23 0.49
24 0.53
25 0.54
26 0.54
27 0.61
28 0.68
29 0.7
30 0.66
31 0.62
32 0.58
33 0.5
34 0.48
35 0.47
36 0.47
37 0.48
38 0.51
39 0.53
40 0.55
41 0.56
42 0.52
43 0.45
44 0.43
45 0.37
46 0.37
47 0.34
48 0.29
49 0.28
50 0.28
51 0.26
52 0.19
53 0.16
54 0.09
55 0.08
56 0.07
57 0.07
58 0.07
59 0.06
60 0.06
61 0.06
62 0.06
63 0.06
64 0.07
65 0.08
66 0.08
67 0.08
68 0.09
69 0.15
70 0.16
71 0.16
72 0.17
73 0.19
74 0.2
75 0.24
76 0.26
77 0.26
78 0.31
79 0.33
80 0.36
81 0.34
82 0.38
83 0.36
84 0.36
85 0.34
86 0.33
87 0.33
88 0.31
89 0.31
90 0.3
91 0.28
92 0.27
93 0.23
94 0.21
95 0.19
96 0.18
97 0.2
98 0.17
99 0.17
100 0.15
101 0.15
102 0.17
103 0.21
104 0.26
105 0.25
106 0.28
107 0.29
108 0.3
109 0.34
110 0.35
111 0.31
112 0.31
113 0.34
114 0.34
115 0.35
116 0.32
117 0.31
118 0.27
119 0.26
120 0.21
121 0.16
122 0.13
123 0.13
124 0.12
125 0.1
126 0.08
127 0.06
128 0.07
129 0.07
130 0.08
131 0.08
132 0.09
133 0.12
134 0.15
135 0.18
136 0.22
137 0.28
138 0.34
139 0.41
140 0.46
141 0.46
142 0.48
143 0.48
144 0.48
145 0.44
146 0.37
147 0.41
148 0.38
149 0.39
150 0.36
151 0.33
152 0.28
153 0.27
154 0.33
155 0.31
156 0.29
157 0.27
158 0.25
159 0.27
160 0.28
161 0.27
162 0.21
163 0.13
164 0.11
165 0.09
166 0.09
167 0.06
168 0.08
169 0.1
170 0.11
171 0.12
172 0.14
173 0.19
174 0.25
175 0.31
176 0.4
177 0.46
178 0.53
179 0.6
180 0.64
181 0.68
182 0.68
183 0.67
184 0.58
185 0.58
186 0.51
187 0.48
188 0.45
189 0.39
190 0.38
191 0.33
192 0.33
193 0.33
194 0.43
195 0.49
196 0.56
197 0.65
198 0.69
199 0.77
200 0.8
201 0.81
202 0.81
203 0.81
204 0.77
205 0.72
206 0.65
207 0.58
208 0.53