Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0U527

Protein Details
Accession F0U527    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
26-62ARTFRFCRSKCHKNFKMKRQPRKLKWTKTHRALHGKEBasic
NLS Segment(s)
PositionSequence
41-53KMKRQPRKLKWTK
104-129QRRERVFTKKRLAGKLAREKKRAEDR
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR011017  TRASH_dom  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MRIETCHFCSQPCYPSKGITFVRNDARTFRFCRSKCHKNFKMKRQPRKLKWTKTHRALHGKEMIVDSSLLLSQFAKRRNIPVKYDRNLVAATIKAMERVEEIRQRRERVFTKKRLAGKLAREKKRAEDRRVVAEGEHLIRKELKEMEEENLPLESLANKNLSHVVGAERLRTKKKTRLLVDGGTQDEMEID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.42
3 0.43
4 0.47
5 0.46
6 0.45
7 0.45
8 0.45
9 0.53
10 0.51
11 0.5
12 0.47
13 0.48
14 0.46
15 0.45
16 0.47
17 0.48
18 0.46
19 0.55
20 0.59
21 0.65
22 0.69
23 0.76
24 0.77
25 0.79
26 0.88
27 0.89
28 0.91
29 0.91
30 0.91
31 0.92
32 0.94
33 0.92
34 0.93
35 0.92
36 0.92
37 0.92
38 0.91
39 0.9
40 0.89
41 0.87
42 0.85
43 0.85
44 0.76
45 0.73
46 0.68
47 0.58
48 0.5
49 0.43
50 0.34
51 0.24
52 0.22
53 0.15
54 0.08
55 0.08
56 0.06
57 0.06
58 0.06
59 0.09
60 0.14
61 0.18
62 0.21
63 0.22
64 0.3
65 0.38
66 0.42
67 0.45
68 0.5
69 0.55
70 0.54
71 0.57
72 0.5
73 0.43
74 0.39
75 0.33
76 0.24
77 0.15
78 0.13
79 0.1
80 0.09
81 0.08
82 0.08
83 0.07
84 0.07
85 0.09
86 0.12
87 0.17
88 0.19
89 0.27
90 0.32
91 0.34
92 0.35
93 0.4
94 0.44
95 0.48
96 0.56
97 0.56
98 0.6
99 0.63
100 0.68
101 0.65
102 0.63
103 0.58
104 0.58
105 0.6
106 0.62
107 0.64
108 0.62
109 0.6
110 0.63
111 0.68
112 0.67
113 0.63
114 0.63
115 0.58
116 0.62
117 0.62
118 0.54
119 0.42
120 0.36
121 0.32
122 0.25
123 0.24
124 0.17
125 0.17
126 0.18
127 0.18
128 0.2
129 0.2
130 0.18
131 0.2
132 0.22
133 0.23
134 0.24
135 0.24
136 0.21
137 0.18
138 0.17
139 0.13
140 0.12
141 0.11
142 0.09
143 0.12
144 0.13
145 0.13
146 0.14
147 0.17
148 0.16
149 0.15
150 0.15
151 0.14
152 0.18
153 0.19
154 0.24
155 0.28
156 0.33
157 0.4
158 0.46
159 0.51
160 0.54
161 0.62
162 0.67
163 0.66
164 0.7
165 0.7
166 0.68
167 0.67
168 0.63
169 0.57
170 0.48
171 0.41