Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0UVN7

Protein Details
Accession F0UVN7    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
28-50VGRLSRSRSHQRRYSSSKPPVPPHydrophilic
353-389VYYAISVKRQRKLKMKKHKHKKLMRRTRTLRRKLDKABasic
NLS Segment(s)
PositionSequence
75-90GAEKREGKPAKRRGGK
360-389KRQRKLKMKKHKHKKLMRRTRTLRRKLDKA
Subcellular Location(s) mito_nucl 13.166, nucl 12.5, mito 12.5, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MFPSSARFLARSSPVITLPPPARPSTAVGRLSRSRSHQRRYSSSKPPVPPSDGSRGIDTSSQSPTKSVSPSNKEGAEKREGKPAKRRGGKDSSNVSTKSKTNEPFLNLPSVPSTQHLHPHDIHVASFFSTHRPISVTTSVPSNSNPDAFDAIFSSKKSSKPRPNDVIYTLSSVVNSIEGVLPNTQSNHPVGNNNLGNAISQGSAKTVDSDHFSNPDDLPMDDLRISIQDFAKKLRPFNPPPPPVPMESFGEQDATLEAETTEAAESELQEDVKEQSYSTLLTITESTHGDGRKTYEAHSSPLVRIDNKDAPSSSVYEGEKVIQDQGGLFSISEPEMNRHRQQHRVPHSMGRKVYYAISVKRQRKLKMKKHKHKKLMRRTRTLRRKLDKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.31
4 0.32
5 0.3
6 0.33
7 0.34
8 0.33
9 0.34
10 0.33
11 0.37
12 0.38
13 0.44
14 0.43
15 0.42
16 0.47
17 0.51
18 0.54
19 0.55
20 0.55
21 0.57
22 0.61
23 0.68
24 0.68
25 0.71
26 0.76
27 0.79
28 0.8
29 0.8
30 0.8
31 0.8
32 0.8
33 0.79
34 0.76
35 0.72
36 0.68
37 0.63
38 0.61
39 0.58
40 0.53
41 0.47
42 0.42
43 0.37
44 0.35
45 0.31
46 0.25
47 0.26
48 0.26
49 0.24
50 0.23
51 0.24
52 0.26
53 0.28
54 0.32
55 0.35
56 0.4
57 0.45
58 0.49
59 0.51
60 0.51
61 0.52
62 0.5
63 0.5
64 0.49
65 0.46
66 0.51
67 0.52
68 0.54
69 0.6
70 0.64
71 0.66
72 0.68
73 0.71
74 0.69
75 0.74
76 0.73
77 0.71
78 0.69
79 0.64
80 0.61
81 0.59
82 0.53
83 0.47
84 0.44
85 0.41
86 0.4
87 0.38
88 0.38
89 0.41
90 0.43
91 0.44
92 0.43
93 0.43
94 0.35
95 0.33
96 0.3
97 0.26
98 0.22
99 0.19
100 0.21
101 0.18
102 0.26
103 0.27
104 0.29
105 0.29
106 0.32
107 0.33
108 0.3
109 0.28
110 0.22
111 0.2
112 0.15
113 0.16
114 0.12
115 0.11
116 0.13
117 0.13
118 0.12
119 0.13
120 0.14
121 0.18
122 0.21
123 0.2
124 0.18
125 0.21
126 0.21
127 0.2
128 0.2
129 0.19
130 0.16
131 0.16
132 0.16
133 0.14
134 0.16
135 0.14
136 0.14
137 0.11
138 0.12
139 0.12
140 0.12
141 0.15
142 0.17
143 0.22
144 0.3
145 0.39
146 0.46
147 0.54
148 0.63
149 0.67
150 0.68
151 0.66
152 0.61
153 0.54
154 0.46
155 0.39
156 0.31
157 0.23
158 0.19
159 0.15
160 0.12
161 0.09
162 0.07
163 0.05
164 0.05
165 0.05
166 0.06
167 0.06
168 0.07
169 0.07
170 0.09
171 0.09
172 0.1
173 0.1
174 0.11
175 0.12
176 0.13
177 0.14
178 0.18
179 0.18
180 0.17
181 0.17
182 0.15
183 0.14
184 0.13
185 0.12
186 0.06
187 0.06
188 0.06
189 0.06
190 0.06
191 0.06
192 0.07
193 0.07
194 0.07
195 0.1
196 0.11
197 0.12
198 0.13
199 0.14
200 0.15
201 0.14
202 0.15
203 0.13
204 0.11
205 0.13
206 0.12
207 0.11
208 0.1
209 0.1
210 0.09
211 0.09
212 0.09
213 0.09
214 0.1
215 0.12
216 0.13
217 0.16
218 0.23
219 0.24
220 0.27
221 0.32
222 0.39
223 0.43
224 0.52
225 0.6
226 0.57
227 0.57
228 0.6
229 0.55
230 0.49
231 0.45
232 0.38
233 0.31
234 0.28
235 0.27
236 0.21
237 0.2
238 0.17
239 0.14
240 0.12
241 0.08
242 0.07
243 0.06
244 0.05
245 0.05
246 0.05
247 0.05
248 0.05
249 0.04
250 0.04
251 0.05
252 0.05
253 0.06
254 0.07
255 0.06
256 0.06
257 0.07
258 0.09
259 0.11
260 0.11
261 0.1
262 0.1
263 0.11
264 0.11
265 0.11
266 0.1
267 0.08
268 0.09
269 0.1
270 0.09
271 0.11
272 0.11
273 0.12
274 0.14
275 0.15
276 0.15
277 0.16
278 0.19
279 0.21
280 0.22
281 0.23
282 0.28
283 0.28
284 0.3
285 0.33
286 0.32
287 0.28
288 0.32
289 0.34
290 0.27
291 0.28
292 0.32
293 0.34
294 0.33
295 0.35
296 0.3
297 0.3
298 0.3
299 0.31
300 0.25
301 0.24
302 0.22
303 0.21
304 0.21
305 0.2
306 0.2
307 0.18
308 0.18
309 0.13
310 0.12
311 0.11
312 0.12
313 0.11
314 0.1
315 0.09
316 0.08
317 0.09
318 0.1
319 0.11
320 0.11
321 0.14
322 0.21
323 0.27
324 0.33
325 0.41
326 0.47
327 0.54
328 0.62
329 0.68
330 0.71
331 0.73
332 0.7
333 0.71
334 0.74
335 0.72
336 0.67
337 0.6
338 0.52
339 0.45
340 0.43
341 0.41
342 0.39
343 0.36
344 0.43
345 0.5
346 0.55
347 0.61
348 0.67
349 0.69
350 0.73
351 0.79
352 0.8
353 0.81
354 0.85
355 0.89
356 0.93
357 0.95
358 0.96
359 0.95
360 0.96
361 0.95
362 0.95
363 0.95
364 0.94
365 0.93
366 0.94
367 0.94
368 0.94
369 0.93