Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0UNG5

Protein Details
Accession F0UNG5    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-29PQNPRPGPYKKPYPVIRRPGSRDMFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MGNGPQNPRPGPYKKPYPVIRRPGSRDMFRRSAFDSNTKGPNGHSIPDADSEPEPNPHDKSSWNQSPVYHSLRISRSPDAGKAYTTNSYHSQPALVSVNKYGRRYRATDSGSPIEISEAFKSSGNSLAINPEQHPYLNGRLFEVYTGPNPGADTTNREETVNISNAANEFLPAPAQSIHCNTEEDPYHRLINDNMDKEANKENAPAETPIPVEEGGKEQLRWSNKHRRPLEALNLSDFYPIDESICPNSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.69
3 0.74
4 0.77
5 0.81
6 0.82
7 0.82
8 0.81
9 0.81
10 0.82
11 0.8
12 0.78
13 0.76
14 0.73
15 0.73
16 0.65
17 0.61
18 0.55
19 0.55
20 0.5
21 0.49
22 0.46
23 0.44
24 0.47
25 0.45
26 0.41
27 0.34
28 0.39
29 0.35
30 0.3
31 0.26
32 0.23
33 0.24
34 0.25
35 0.25
36 0.19
37 0.17
38 0.18
39 0.18
40 0.2
41 0.2
42 0.22
43 0.24
44 0.23
45 0.23
46 0.23
47 0.28
48 0.34
49 0.39
50 0.39
51 0.38
52 0.37
53 0.42
54 0.46
55 0.45
56 0.37
57 0.31
58 0.34
59 0.36
60 0.39
61 0.37
62 0.33
63 0.32
64 0.31
65 0.34
66 0.32
67 0.29
68 0.26
69 0.23
70 0.23
71 0.24
72 0.23
73 0.24
74 0.22
75 0.23
76 0.23
77 0.21
78 0.2
79 0.15
80 0.17
81 0.17
82 0.15
83 0.14
84 0.16
85 0.23
86 0.26
87 0.29
88 0.29
89 0.3
90 0.32
91 0.35
92 0.36
93 0.38
94 0.39
95 0.39
96 0.41
97 0.39
98 0.36
99 0.32
100 0.28
101 0.2
102 0.16
103 0.14
104 0.1
105 0.09
106 0.09
107 0.09
108 0.1
109 0.1
110 0.12
111 0.11
112 0.11
113 0.1
114 0.12
115 0.12
116 0.13
117 0.13
118 0.11
119 0.11
120 0.11
121 0.11
122 0.11
123 0.15
124 0.17
125 0.16
126 0.16
127 0.16
128 0.16
129 0.15
130 0.14
131 0.1
132 0.09
133 0.1
134 0.09
135 0.08
136 0.09
137 0.09
138 0.1
139 0.09
140 0.13
141 0.16
142 0.2
143 0.2
144 0.2
145 0.2
146 0.2
147 0.23
148 0.21
149 0.18
150 0.14
151 0.14
152 0.14
153 0.15
154 0.13
155 0.09
156 0.07
157 0.06
158 0.07
159 0.06
160 0.07
161 0.08
162 0.09
163 0.11
164 0.14
165 0.16
166 0.16
167 0.18
168 0.18
169 0.22
170 0.24
171 0.25
172 0.24
173 0.24
174 0.25
175 0.23
176 0.24
177 0.2
178 0.26
179 0.3
180 0.3
181 0.29
182 0.3
183 0.3
184 0.31
185 0.36
186 0.3
187 0.23
188 0.23
189 0.23
190 0.23
191 0.25
192 0.23
193 0.18
194 0.17
195 0.17
196 0.15
197 0.16
198 0.14
199 0.12
200 0.12
201 0.14
202 0.17
203 0.18
204 0.18
205 0.18
206 0.24
207 0.29
208 0.34
209 0.39
210 0.46
211 0.51
212 0.61
213 0.63
214 0.64
215 0.66
216 0.7
217 0.72
218 0.69
219 0.64
220 0.59
221 0.56
222 0.49
223 0.43
224 0.34
225 0.25
226 0.19
227 0.16
228 0.14
229 0.14
230 0.16