Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UIK9

Protein Details
Accession Q0UIK9    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
70-89RRAITTRKTKKTSNKRRELSHydrophilic
NLS Segment(s)
PositionSequence
77-86KTKKTSNKRR
Subcellular Location(s) nucl 9, plas 4, pero 3, E.R. 3, cyto 2, extr 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR018253  DnaJ_domain_CS  
IPR036869  J_dom_sf  
Gene Ontology GO:0016020  C:membrane  
KEGG pno:SNOG_08405  -  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS00636  DNAJ_1  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MLVNWANDSECLGPFIYFPLSSINLLYICLFLNNTNHMHKLISMLVVLVVIAFETRFGAWLRGHIWACIRRAITTRKTKKTSNKRRELSTSKNQGQRGKAPPAAALPTPSETLRYHPDKQLSNDTSAFRKVNEAYEVLRNPLQRRKYDLTYNFVRRELETYREAWREYEKETEQQPEQAMELYAGPHQAVPRNLQRKTLHPMPPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.14
4 0.12
5 0.12
6 0.14
7 0.16
8 0.16
9 0.16
10 0.16
11 0.13
12 0.14
13 0.14
14 0.11
15 0.09
16 0.09
17 0.09
18 0.09
19 0.12
20 0.15
21 0.18
22 0.2
23 0.21
24 0.22
25 0.21
26 0.2
27 0.2
28 0.17
29 0.15
30 0.12
31 0.1
32 0.09
33 0.09
34 0.08
35 0.05
36 0.04
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.04
43 0.05
44 0.06
45 0.09
46 0.09
47 0.12
48 0.13
49 0.18
50 0.18
51 0.18
52 0.22
53 0.24
54 0.25
55 0.27
56 0.26
57 0.22
58 0.26
59 0.32
60 0.36
61 0.43
62 0.51
63 0.56
64 0.6
65 0.66
66 0.72
67 0.77
68 0.79
69 0.79
70 0.8
71 0.76
72 0.76
73 0.78
74 0.74
75 0.71
76 0.7
77 0.68
78 0.64
79 0.65
80 0.64
81 0.6
82 0.56
83 0.55
84 0.5
85 0.46
86 0.41
87 0.36
88 0.33
89 0.29
90 0.28
91 0.21
92 0.16
93 0.12
94 0.12
95 0.13
96 0.12
97 0.13
98 0.12
99 0.15
100 0.2
101 0.24
102 0.25
103 0.28
104 0.33
105 0.33
106 0.37
107 0.43
108 0.39
109 0.37
110 0.37
111 0.35
112 0.32
113 0.32
114 0.29
115 0.2
116 0.21
117 0.19
118 0.19
119 0.19
120 0.18
121 0.17
122 0.22
123 0.22
124 0.22
125 0.23
126 0.24
127 0.26
128 0.32
129 0.36
130 0.33
131 0.4
132 0.44
133 0.46
134 0.53
135 0.53
136 0.52
137 0.55
138 0.6
139 0.55
140 0.5
141 0.46
142 0.38
143 0.38
144 0.34
145 0.3
146 0.25
147 0.25
148 0.29
149 0.31
150 0.3
151 0.28
152 0.31
153 0.28
154 0.29
155 0.34
156 0.31
157 0.33
158 0.36
159 0.39
160 0.35
161 0.36
162 0.35
163 0.28
164 0.26
165 0.22
166 0.2
167 0.15
168 0.14
169 0.11
170 0.11
171 0.1
172 0.1
173 0.1
174 0.12
175 0.17
176 0.19
177 0.25
178 0.35
179 0.43
180 0.44
181 0.51
182 0.53
183 0.53
184 0.6
185 0.63