Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0UV95

Protein Details
Accession F0UV95   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
8-37RTGCPYMSRKHKASKHKARRKGKEFEKSNVBasic
NLS Segment(s)
PositionSequence
16-30RKHKASKHKARRKGK
Subcellular Location(s) nucl 18, mito 5, cyto 4
Family & Domain DBs
Amino Acid Sequences MTKQGNNRTGCPYMSRKHKASKHKARRKGKEFEKSNVGQGFETRIVVVGAALDIDIRTPARVEQQARPAQYSKVKPTPCSLSPNPLRAAFDTPDIIAGDANALSRKTVQSHAPNRRTSFRFPGPAPNIPPRVKVALRDASRLCMKDTANDLATILGSVH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.57
3 0.57
4 0.64
5 0.7
6 0.75
7 0.79
8 0.82
9 0.83
10 0.86
11 0.9
12 0.91
13 0.94
14 0.91
15 0.91
16 0.89
17 0.88
18 0.83
19 0.79
20 0.76
21 0.67
22 0.65
23 0.57
24 0.48
25 0.37
26 0.32
27 0.3
28 0.23
29 0.21
30 0.14
31 0.12
32 0.11
33 0.1
34 0.09
35 0.05
36 0.04
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.04
43 0.04
44 0.04
45 0.05
46 0.06
47 0.1
48 0.15
49 0.18
50 0.22
51 0.31
52 0.35
53 0.35
54 0.37
55 0.34
56 0.33
57 0.36
58 0.36
59 0.34
60 0.37
61 0.37
62 0.36
63 0.38
64 0.4
65 0.36
66 0.4
67 0.34
68 0.35
69 0.37
70 0.4
71 0.38
72 0.34
73 0.32
74 0.26
75 0.29
76 0.21
77 0.19
78 0.16
79 0.13
80 0.13
81 0.12
82 0.11
83 0.07
84 0.06
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.06
91 0.07
92 0.08
93 0.1
94 0.13
95 0.19
96 0.28
97 0.38
98 0.48
99 0.54
100 0.59
101 0.61
102 0.66
103 0.64
104 0.6
105 0.58
106 0.54
107 0.53
108 0.49
109 0.56
110 0.54
111 0.56
112 0.55
113 0.55
114 0.55
115 0.51
116 0.51
117 0.45
118 0.45
119 0.41
120 0.4
121 0.39
122 0.41
123 0.42
124 0.46
125 0.43
126 0.43
127 0.47
128 0.44
129 0.39
130 0.35
131 0.33
132 0.32
133 0.36
134 0.36
135 0.31
136 0.3
137 0.28
138 0.23
139 0.23