Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0UND8

Protein Details
Accession F0UND8    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
380-404DELAKKGEKKTTKNEDVKKRSNSGVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 9, mito 6, cyto 5.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016757  F:glycosyltransferase activity  
GO:0048856  P:anatomical structure development  
GO:0043934  P:sporulation  
Pfam View protein in Pfam  
PF03452  Anp1  
Amino Acid Sequences MATQPTHMGRAGHSRSHLTDDFQLETVRYYDLSNFQGTARGWERQERVLLCTPLRDAAPHLPMFFSHLRNLTYPHHLIDLAFLVSDSKDDTLEMLTKMLEELQADPDSKQHYGEISVIEKDFGQKVNQDVESRHGFAAQASRRKLMAQARNWLLSATLRPTHSWVYWRDADVETAPFTILEDLMRHNKDVIVPNVWRPLPDWLGGEQPYDLNSWKESETALALAETLDEDAVIVEGYAEYATWRPHLAYLRDPYGDPDTEMEIDGVGGVSILAKARVFRSGVHFPAFSFEKHAETEAFGKMAKRMKFSVVGLPHYTIWHLYEPSLDDIRHMEEMERERKEREEEEKKKAELAQLMKEEFKDTKDEWEKDGKAIQNILKQDELAKKGEKKTTKNEDVKKRSNSGVEDVDKRQQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.4
3 0.46
4 0.44
5 0.38
6 0.39
7 0.37
8 0.37
9 0.33
10 0.32
11 0.25
12 0.25
13 0.22
14 0.17
15 0.14
16 0.13
17 0.15
18 0.18
19 0.21
20 0.21
21 0.21
22 0.2
23 0.25
24 0.24
25 0.28
26 0.28
27 0.3
28 0.3
29 0.37
30 0.4
31 0.39
32 0.46
33 0.4
34 0.42
35 0.44
36 0.46
37 0.39
38 0.38
39 0.35
40 0.31
41 0.3
42 0.25
43 0.22
44 0.24
45 0.3
46 0.28
47 0.28
48 0.26
49 0.25
50 0.3
51 0.3
52 0.26
53 0.24
54 0.26
55 0.28
56 0.28
57 0.33
58 0.31
59 0.33
60 0.33
61 0.29
62 0.28
63 0.26
64 0.25
65 0.22
66 0.2
67 0.13
68 0.11
69 0.09
70 0.08
71 0.08
72 0.09
73 0.08
74 0.07
75 0.07
76 0.07
77 0.08
78 0.09
79 0.11
80 0.11
81 0.11
82 0.1
83 0.1
84 0.1
85 0.1
86 0.09
87 0.07
88 0.08
89 0.12
90 0.14
91 0.14
92 0.14
93 0.17
94 0.19
95 0.19
96 0.18
97 0.15
98 0.14
99 0.15
100 0.16
101 0.16
102 0.14
103 0.16
104 0.15
105 0.15
106 0.14
107 0.14
108 0.15
109 0.14
110 0.13
111 0.13
112 0.16
113 0.2
114 0.22
115 0.22
116 0.21
117 0.25
118 0.27
119 0.26
120 0.24
121 0.2
122 0.18
123 0.17
124 0.25
125 0.25
126 0.29
127 0.28
128 0.3
129 0.3
130 0.3
131 0.35
132 0.35
133 0.38
134 0.36
135 0.43
136 0.44
137 0.45
138 0.44
139 0.38
140 0.3
141 0.23
142 0.19
143 0.15
144 0.15
145 0.15
146 0.16
147 0.18
148 0.2
149 0.2
150 0.23
151 0.22
152 0.24
153 0.26
154 0.26
155 0.26
156 0.24
157 0.24
158 0.2
159 0.19
160 0.13
161 0.12
162 0.11
163 0.08
164 0.07
165 0.07
166 0.06
167 0.05
168 0.05
169 0.07
170 0.13
171 0.14
172 0.14
173 0.14
174 0.15
175 0.18
176 0.21
177 0.21
178 0.2
179 0.2
180 0.22
181 0.26
182 0.25
183 0.22
184 0.18
185 0.2
186 0.17
187 0.18
188 0.17
189 0.13
190 0.16
191 0.16
192 0.16
193 0.12
194 0.11
195 0.1
196 0.1
197 0.1
198 0.08
199 0.08
200 0.09
201 0.09
202 0.09
203 0.09
204 0.08
205 0.08
206 0.07
207 0.07
208 0.05
209 0.05
210 0.04
211 0.04
212 0.04
213 0.03
214 0.03
215 0.02
216 0.02
217 0.02
218 0.03
219 0.02
220 0.02
221 0.02
222 0.02
223 0.03
224 0.02
225 0.02
226 0.03
227 0.05
228 0.05
229 0.06
230 0.07
231 0.07
232 0.1
233 0.15
234 0.17
235 0.21
236 0.25
237 0.27
238 0.27
239 0.27
240 0.26
241 0.25
242 0.23
243 0.18
244 0.15
245 0.14
246 0.14
247 0.14
248 0.11
249 0.08
250 0.07
251 0.07
252 0.05
253 0.03
254 0.03
255 0.02
256 0.02
257 0.03
258 0.03
259 0.04
260 0.04
261 0.06
262 0.07
263 0.1
264 0.1
265 0.12
266 0.19
267 0.24
268 0.26
269 0.27
270 0.27
271 0.24
272 0.28
273 0.28
274 0.21
275 0.2
276 0.18
277 0.18
278 0.18
279 0.2
280 0.16
281 0.16
282 0.18
283 0.15
284 0.14
285 0.13
286 0.13
287 0.17
288 0.23
289 0.24
290 0.25
291 0.26
292 0.28
293 0.31
294 0.32
295 0.36
296 0.33
297 0.34
298 0.33
299 0.33
300 0.3
301 0.27
302 0.26
303 0.19
304 0.17
305 0.16
306 0.15
307 0.13
308 0.14
309 0.16
310 0.19
311 0.21
312 0.19
313 0.17
314 0.18
315 0.2
316 0.2
317 0.18
318 0.15
319 0.18
320 0.25
321 0.32
322 0.34
323 0.34
324 0.35
325 0.38
326 0.42
327 0.42
328 0.45
329 0.48
330 0.52
331 0.6
332 0.65
333 0.62
334 0.61
335 0.57
336 0.52
337 0.48
338 0.45
339 0.43
340 0.41
341 0.43
342 0.41
343 0.39
344 0.37
345 0.31
346 0.28
347 0.26
348 0.22
349 0.31
350 0.39
351 0.4
352 0.41
353 0.49
354 0.48
355 0.46
356 0.51
357 0.45
358 0.39
359 0.43
360 0.43
361 0.39
362 0.41
363 0.41
364 0.36
365 0.32
366 0.35
367 0.37
368 0.36
369 0.35
370 0.39
371 0.43
372 0.5
373 0.58
374 0.6
375 0.6
376 0.67
377 0.74
378 0.77
379 0.8
380 0.82
381 0.85
382 0.87
383 0.89
384 0.86
385 0.8
386 0.76
387 0.72
388 0.67
389 0.62
390 0.6
391 0.57
392 0.55
393 0.54