Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F0UWE8

Protein Details
Accession F0UWE8    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
90-114YLSELRKKKYFIKKKNKLNLLKMIGHydrophilic
NLS Segment(s)
PositionSequence
96-106KKKYFIKKKNK
Subcellular Location(s) mito 15, nucl 6.5, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036419  Ribosomal_S3_C_sf  
IPR007980  Ribosomal_VAR1  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05316  VAR1  
Amino Acid Sequences MIRNWKNSIYVYNKKNITLISEINEISINLIKNYFNAYYSKTKNFFRTRLIYKKYLTSKHRIFFSDAQLKHTNDLVNITIYFYDPKIRLYLSELRKKKYFIKKKNKLNLLKMIGKYFILKQRRITKNILLNNFDKCNFKNLKLFTNLYYNLFLNKTFKIAKLYLYILQLIYINKSKFRNNYLQGLVNIIKKLYKKNVQFNFVNIKYYFFNSQIITQRFVLDIQKNRKYLNKSLKKIIKNIPLEKKSLLILYPNNKYIFNWNFIKDNYNKLDITNDILYDILLKNKSKSNNLKKTIFDDIKYKKVAGIKLQANGRLTRRFTAARSLTKNKIKGSIANINSSFYGNSSNLLRGKFRSNIDYTNLNNNSALGSFGIKGWLSGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.54
3 0.46
4 0.41
5 0.37
6 0.34
7 0.3
8 0.31
9 0.3
10 0.28
11 0.27
12 0.22
13 0.19
14 0.2
15 0.16
16 0.14
17 0.16
18 0.15
19 0.15
20 0.2
21 0.19
22 0.17
23 0.18
24 0.23
25 0.3
26 0.36
27 0.43
28 0.43
29 0.48
30 0.56
31 0.62
32 0.62
33 0.61
34 0.64
35 0.65
36 0.71
37 0.72
38 0.69
39 0.63
40 0.67
41 0.68
42 0.68
43 0.65
44 0.65
45 0.67
46 0.66
47 0.68
48 0.62
49 0.6
50 0.56
51 0.59
52 0.59
53 0.51
54 0.52
55 0.53
56 0.51
57 0.45
58 0.43
59 0.35
60 0.26
61 0.27
62 0.22
63 0.18
64 0.17
65 0.16
66 0.13
67 0.13
68 0.13
69 0.11
70 0.16
71 0.14
72 0.16
73 0.17
74 0.17
75 0.17
76 0.21
77 0.3
78 0.34
79 0.43
80 0.47
81 0.5
82 0.53
83 0.56
84 0.59
85 0.62
86 0.64
87 0.65
88 0.72
89 0.77
90 0.84
91 0.91
92 0.91
93 0.88
94 0.85
95 0.83
96 0.78
97 0.75
98 0.66
99 0.58
100 0.49
101 0.41
102 0.35
103 0.31
104 0.32
105 0.31
106 0.32
107 0.38
108 0.48
109 0.54
110 0.57
111 0.57
112 0.56
113 0.58
114 0.62
115 0.59
116 0.52
117 0.48
118 0.47
119 0.44
120 0.38
121 0.33
122 0.27
123 0.31
124 0.3
125 0.31
126 0.33
127 0.33
128 0.37
129 0.38
130 0.39
131 0.32
132 0.36
133 0.34
134 0.29
135 0.29
136 0.24
137 0.21
138 0.2
139 0.19
140 0.15
141 0.14
142 0.16
143 0.15
144 0.16
145 0.19
146 0.19
147 0.2
148 0.2
149 0.22
150 0.21
151 0.2
152 0.2
153 0.15
154 0.15
155 0.15
156 0.12
157 0.12
158 0.14
159 0.14
160 0.17
161 0.2
162 0.23
163 0.25
164 0.3
165 0.36
166 0.35
167 0.4
168 0.38
169 0.39
170 0.35
171 0.35
172 0.31
173 0.25
174 0.22
175 0.16
176 0.16
177 0.15
178 0.19
179 0.22
180 0.28
181 0.32
182 0.42
183 0.46
184 0.5
185 0.49
186 0.49
187 0.51
188 0.44
189 0.42
190 0.32
191 0.29
192 0.24
193 0.26
194 0.24
195 0.16
196 0.17
197 0.14
198 0.19
199 0.24
200 0.25
201 0.26
202 0.24
203 0.24
204 0.22
205 0.22
206 0.23
207 0.21
208 0.27
209 0.33
210 0.38
211 0.39
212 0.4
213 0.45
214 0.46
215 0.5
216 0.53
217 0.55
218 0.53
219 0.62
220 0.68
221 0.66
222 0.68
223 0.67
224 0.65
225 0.62
226 0.67
227 0.67
228 0.62
229 0.6
230 0.53
231 0.46
232 0.38
233 0.31
234 0.23
235 0.18
236 0.2
237 0.24
238 0.27
239 0.3
240 0.3
241 0.29
242 0.3
243 0.34
244 0.32
245 0.31
246 0.31
247 0.29
248 0.31
249 0.31
250 0.37
251 0.3
252 0.35
253 0.32
254 0.32
255 0.31
256 0.28
257 0.3
258 0.24
259 0.27
260 0.2
261 0.17
262 0.13
263 0.13
264 0.12
265 0.12
266 0.12
267 0.12
268 0.14
269 0.16
270 0.18
271 0.23
272 0.28
273 0.35
274 0.45
275 0.52
276 0.6
277 0.66
278 0.68
279 0.66
280 0.66
281 0.67
282 0.6
283 0.5
284 0.5
285 0.48
286 0.49
287 0.49
288 0.44
289 0.37
290 0.39
291 0.41
292 0.38
293 0.42
294 0.4
295 0.43
296 0.47
297 0.47
298 0.45
299 0.46
300 0.44
301 0.42
302 0.41
303 0.38
304 0.39
305 0.38
306 0.37
307 0.42
308 0.44
309 0.46
310 0.51
311 0.56
312 0.6
313 0.65
314 0.69
315 0.62
316 0.62
317 0.56
318 0.53
319 0.54
320 0.54
321 0.49
322 0.51
323 0.49
324 0.43
325 0.41
326 0.37
327 0.29
328 0.2
329 0.22
330 0.14
331 0.16
332 0.17
333 0.22
334 0.24
335 0.26
336 0.29
337 0.28
338 0.34
339 0.37
340 0.39
341 0.41
342 0.42
343 0.44
344 0.45
345 0.49
346 0.45
347 0.5
348 0.48
349 0.42
350 0.38
351 0.34
352 0.3
353 0.24
354 0.21
355 0.12
356 0.12
357 0.11
358 0.11
359 0.14
360 0.13