Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0UTQ3

Protein Details
Accession F0UTQ3   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
98-127WEGGKGTRDKRRMNRKDPRKYKRQGGTTTGBasic
NLS Segment(s)
PositionSequence
102-122KGTRDKRRMNRKDPRKYKRQG
Subcellular Location(s) mito 18, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR008913  Znf_CHY  
IPR037274  Znf_CHY_sf  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF05495  zf-CHY  
PROSITE View protein in PROSITE  
PS51266  ZF_CHY  
Amino Acid Sequences MYIFGTLKSKEILGIVAGQELPRRGRCSHYGKSYRWFRFSCCLKVFPCDRCHDAATDHPNEHANRMICGFCSREQIYRPDSCGICHSTLVGKAGSGFWEGGKGTRDKRRMNRKDPRKYKRQGGTTTGPSAQKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.12
4 0.12
5 0.12
6 0.13
7 0.15
8 0.18
9 0.2
10 0.24
11 0.24
12 0.29
13 0.37
14 0.43
15 0.49
16 0.55
17 0.59
18 0.58
19 0.66
20 0.71
21 0.68
22 0.66
23 0.59
24 0.52
25 0.54
26 0.56
27 0.55
28 0.48
29 0.47
30 0.41
31 0.47
32 0.48
33 0.44
34 0.43
35 0.39
36 0.39
37 0.37
38 0.37
39 0.32
40 0.29
41 0.29
42 0.3
43 0.28
44 0.26
45 0.24
46 0.27
47 0.26
48 0.25
49 0.23
50 0.17
51 0.15
52 0.16
53 0.15
54 0.12
55 0.13
56 0.14
57 0.11
58 0.16
59 0.17
60 0.18
61 0.2
62 0.24
63 0.27
64 0.26
65 0.27
66 0.26
67 0.25
68 0.24
69 0.25
70 0.24
71 0.2
72 0.19
73 0.17
74 0.14
75 0.15
76 0.16
77 0.13
78 0.1
79 0.09
80 0.09
81 0.1
82 0.09
83 0.08
84 0.07
85 0.09
86 0.09
87 0.11
88 0.13
89 0.16
90 0.22
91 0.3
92 0.38
93 0.45
94 0.56
95 0.65
96 0.72
97 0.8
98 0.84
99 0.87
100 0.9
101 0.93
102 0.92
103 0.91
104 0.9
105 0.89
106 0.88
107 0.86
108 0.82
109 0.79
110 0.77
111 0.73
112 0.69
113 0.64