Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0U9L3

Protein Details
Accession F0U9L3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
55-74LFIKNKSKWINKERTRWAKTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 10, cyto_pero 6.833, cyto_nucl 6.333, mito_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001853  DSBA-like_thioredoxin_dom  
IPR014440  HCCAis_GSTk  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0004364  F:glutathione transferase activity  
GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF01323  DSBA  
Amino Acid Sequences MAAPRINLYLDVVSPFAYIAYYVTRHSPVFAKCEISYTPVFLGGILKACNNVSPLFIKNKSKWINKERTRWAKTLNVPIYSTTPEGFPISTMNVQRALCTIPAKSLPVCFDALYQEFWVAGNPKISDPDTFRPILESAVGKEMAANAVAQAVEIGAFGVPWFECTNGSGETECFWGVDHMGQMAAFLGLDVTADKGFRAMM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.09
4 0.07
5 0.07
6 0.06
7 0.09
8 0.1
9 0.11
10 0.14
11 0.17
12 0.17
13 0.19
14 0.24
15 0.23
16 0.27
17 0.27
18 0.29
19 0.26
20 0.29
21 0.28
22 0.27
23 0.25
24 0.22
25 0.2
26 0.17
27 0.16
28 0.13
29 0.14
30 0.1
31 0.12
32 0.1
33 0.1
34 0.1
35 0.11
36 0.12
37 0.12
38 0.12
39 0.11
40 0.13
41 0.16
42 0.22
43 0.26
44 0.32
45 0.32
46 0.41
47 0.47
48 0.52
49 0.59
50 0.62
51 0.68
52 0.7
53 0.77
54 0.78
55 0.81
56 0.78
57 0.71
58 0.66
59 0.63
60 0.6
61 0.61
62 0.54
63 0.45
64 0.41
65 0.39
66 0.37
67 0.31
68 0.26
69 0.16
70 0.13
71 0.12
72 0.12
73 0.1
74 0.09
75 0.08
76 0.09
77 0.11
78 0.12
79 0.11
80 0.15
81 0.15
82 0.14
83 0.14
84 0.13
85 0.12
86 0.13
87 0.12
88 0.09
89 0.1
90 0.11
91 0.11
92 0.11
93 0.11
94 0.12
95 0.13
96 0.11
97 0.11
98 0.12
99 0.13
100 0.12
101 0.11
102 0.09
103 0.08
104 0.08
105 0.09
106 0.09
107 0.09
108 0.1
109 0.11
110 0.11
111 0.13
112 0.14
113 0.15
114 0.19
115 0.22
116 0.24
117 0.24
118 0.23
119 0.23
120 0.23
121 0.21
122 0.17
123 0.14
124 0.11
125 0.13
126 0.13
127 0.11
128 0.11
129 0.11
130 0.09
131 0.09
132 0.07
133 0.04
134 0.05
135 0.05
136 0.05
137 0.04
138 0.04
139 0.03
140 0.03
141 0.04
142 0.03
143 0.03
144 0.03
145 0.04
146 0.04
147 0.06
148 0.07
149 0.07
150 0.08
151 0.09
152 0.12
153 0.12
154 0.14
155 0.12
156 0.12
157 0.13
158 0.14
159 0.13
160 0.1
161 0.1
162 0.09
163 0.09
164 0.11
165 0.1
166 0.09
167 0.09
168 0.09
169 0.08
170 0.08
171 0.07
172 0.05
173 0.04
174 0.04
175 0.03
176 0.04
177 0.04
178 0.06
179 0.06
180 0.07
181 0.07