Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F0U6E1

Protein Details
Accession F0U6E1    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
70-94CAYSSAKKRKGKGRKKKEYHIPIIEBasic
NLS Segment(s)
PositionSequence
75-86AKKRKGKGRKKK
Subcellular Location(s) mito 15, nucl 10.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MTSIKSLGFDIAKGKRIRRWLGLVDSHVASKDIPADNGEQNISKSPSSRQVTKVEDKEEYPQYLANMLPCAYSSAKKRKGKGRKKKEYHIPIIESKLIISGASLWTAWDSQGVCLFKCHYNGDKRQETAPRDSDKHISESKSGEWSGNGAFGIRGPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.4
3 0.48
4 0.53
5 0.51
6 0.53
7 0.52
8 0.55
9 0.55
10 0.52
11 0.47
12 0.42
13 0.36
14 0.3
15 0.25
16 0.17
17 0.13
18 0.16
19 0.14
20 0.13
21 0.14
22 0.17
23 0.18
24 0.2
25 0.2
26 0.16
27 0.16
28 0.19
29 0.19
30 0.16
31 0.16
32 0.18
33 0.26
34 0.3
35 0.33
36 0.34
37 0.39
38 0.45
39 0.51
40 0.52
41 0.46
42 0.43
43 0.4
44 0.41
45 0.37
46 0.32
47 0.24
48 0.21
49 0.18
50 0.17
51 0.16
52 0.12
53 0.1
54 0.09
55 0.08
56 0.07
57 0.09
58 0.09
59 0.12
60 0.18
61 0.27
62 0.36
63 0.41
64 0.46
65 0.54
66 0.64
67 0.72
68 0.77
69 0.79
70 0.8
71 0.83
72 0.87
73 0.87
74 0.85
75 0.82
76 0.76
77 0.69
78 0.61
79 0.56
80 0.48
81 0.37
82 0.28
83 0.2
84 0.15
85 0.11
86 0.07
87 0.06
88 0.05
89 0.06
90 0.06
91 0.05
92 0.06
93 0.06
94 0.06
95 0.07
96 0.07
97 0.08
98 0.13
99 0.14
100 0.13
101 0.15
102 0.17
103 0.18
104 0.21
105 0.24
106 0.26
107 0.34
108 0.42
109 0.5
110 0.53
111 0.53
112 0.56
113 0.59
114 0.57
115 0.56
116 0.55
117 0.53
118 0.5
119 0.52
120 0.52
121 0.47
122 0.48
123 0.45
124 0.41
125 0.37
126 0.37
127 0.36
128 0.35
129 0.33
130 0.28
131 0.24
132 0.23
133 0.2
134 0.19
135 0.16
136 0.12
137 0.11