Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0UK40

Protein Details
Accession F0UK40    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
6-33AVGPVVGRKCRRPRKASNKVNKRRVSGFHydrophilic
NLS Segment(s)
PositionSequence
14-29KCRRPRKASNKVNKRR
Subcellular Location(s) mito 18.5, cyto_mito 11, cyto 2.5, nucl 2, pero 2
Family & Domain DBs
Amino Acid Sequences MHLLQAVGPVVGRKCRRPRKASNKVNKRRVSGFGTASWRLGRHNVKTLVGWIVCGTASVLWIRGRDDADPCLWGNFVVSLQIQKFYPRDFQYTVHFNSTCANDQLWHKSNAACGGGNKRMAHGYPGTEVSLKAVASYGVPGLAPDLARSGLGFLGFKQLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.55
3 0.65
4 0.71
5 0.8
6 0.83
7 0.9
8 0.91
9 0.92
10 0.92
11 0.93
12 0.94
13 0.89
14 0.83
15 0.77
16 0.72
17 0.66
18 0.61
19 0.53
20 0.48
21 0.47
22 0.43
23 0.4
24 0.35
25 0.29
26 0.25
27 0.3
28 0.31
29 0.29
30 0.36
31 0.37
32 0.37
33 0.36
34 0.37
35 0.33
36 0.27
37 0.23
38 0.15
39 0.12
40 0.11
41 0.1
42 0.09
43 0.04
44 0.05
45 0.05
46 0.07
47 0.08
48 0.08
49 0.09
50 0.11
51 0.12
52 0.12
53 0.14
54 0.14
55 0.13
56 0.14
57 0.13
58 0.12
59 0.11
60 0.09
61 0.08
62 0.06
63 0.06
64 0.05
65 0.05
66 0.06
67 0.06
68 0.08
69 0.08
70 0.1
71 0.11
72 0.11
73 0.17
74 0.18
75 0.22
76 0.22
77 0.24
78 0.26
79 0.3
80 0.31
81 0.29
82 0.27
83 0.23
84 0.24
85 0.25
86 0.22
87 0.19
88 0.17
89 0.15
90 0.17
91 0.25
92 0.26
93 0.25
94 0.24
95 0.24
96 0.26
97 0.26
98 0.25
99 0.19
100 0.18
101 0.22
102 0.25
103 0.29
104 0.27
105 0.26
106 0.26
107 0.25
108 0.26
109 0.22
110 0.2
111 0.18
112 0.19
113 0.19
114 0.18
115 0.17
116 0.16
117 0.16
118 0.14
119 0.11
120 0.1
121 0.09
122 0.09
123 0.1
124 0.08
125 0.06
126 0.06
127 0.06
128 0.07
129 0.08
130 0.08
131 0.07
132 0.09
133 0.09
134 0.09
135 0.09
136 0.1
137 0.09
138 0.1
139 0.1
140 0.09