Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F0UVK2

Protein Details
Accession F0UVK2    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
21-48VLEGRVGKKGNKKRKKEKERGKDKEGGNBasic
NLS Segment(s)
PositionSequence
13-45KLKIKGAPVLEGRVGKKGNKKRKKEKERGKDKE
115-125RRKRLDERFKR
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MAPANEYVSGGGKLKIKGAPVLEGRVGKKGNKKRKKEKERGKDKEGGNEGPNGSHDEGADGMRMKSGEGEGAVRSDGDWDVSRSRSRSRSRGVGEGFDKAVVSKTEAERRYEEARRKRLDERFKREGFKTHKERVEELNRYLSNLSEHHDMPRIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.23
4 0.26
5 0.26
6 0.29
7 0.27
8 0.3
9 0.3
10 0.32
11 0.31
12 0.33
13 0.34
14 0.33
15 0.41
16 0.48
17 0.56
18 0.62
19 0.71
20 0.76
21 0.86
22 0.92
23 0.93
24 0.94
25 0.93
26 0.95
27 0.93
28 0.88
29 0.85
30 0.75
31 0.73
32 0.67
33 0.59
34 0.49
35 0.44
36 0.37
37 0.29
38 0.28
39 0.22
40 0.18
41 0.15
42 0.13
43 0.11
44 0.11
45 0.11
46 0.11
47 0.08
48 0.08
49 0.08
50 0.08
51 0.07
52 0.07
53 0.07
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.05
62 0.06
63 0.05
64 0.06
65 0.06
66 0.07
67 0.09
68 0.11
69 0.13
70 0.14
71 0.18
72 0.25
73 0.3
74 0.35
75 0.38
76 0.44
77 0.45
78 0.5
79 0.47
80 0.44
81 0.4
82 0.35
83 0.3
84 0.23
85 0.2
86 0.13
87 0.14
88 0.09
89 0.1
90 0.12
91 0.15
92 0.23
93 0.25
94 0.28
95 0.29
96 0.33
97 0.38
98 0.42
99 0.48
100 0.5
101 0.57
102 0.59
103 0.62
104 0.65
105 0.68
106 0.72
107 0.73
108 0.73
109 0.73
110 0.73
111 0.74
112 0.68
113 0.69
114 0.65
115 0.65
116 0.65
117 0.64
118 0.65
119 0.63
120 0.64
121 0.64
122 0.66
123 0.61
124 0.56
125 0.56
126 0.5
127 0.48
128 0.45
129 0.37
130 0.3
131 0.25
132 0.27
133 0.22
134 0.23
135 0.24
136 0.29
137 0.28